KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7926Help
Entry
Dmel_CG7926       CDS       T00030                                 

Gene name
Axn
Definition
(RefSeq) axin, isoform A
  KO
K02157  axin 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG7926 (Axn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG7926 (Axn)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG7926 (Axn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX Axin_b-cat_bind RGS AXIN1_TNKS_BD
Motif
Other DBs
NCBI-GeneID: 43565
NCBI-ProteinID: NP_733336
FlyBase: FBgn0026597
UniProt: Q9V407 A4V3M5
Position
3R
AA seq 745 aa AA seqDB search
MSGHPSGIRKHDDNECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLE
DRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYRFLRKSQLSIS
DDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQE
RCTSSGATGSGSAGSSGSGGSSLAGACALPPTTASGKQQLPQLVPPGAFINLPVSSVSGP
PAGTCSASGSVYGPSTSASSSGSISATDTLPRSSTLPTLHEDSVLSLCDDFEKVQMQEGG
GSLGSGSVGAGARAPDYPIRLTRDLLIATQKRRLEIRPPGAHGYVYNPSTTNTSYVPNSR
VDSERASVSSGGRTDSDTMSISSCSMDGRPYIQRRHSSTESKAIRQSAMANKETNTFQVI
PRTQRLHSNEHRPLKEEELVSLLIPKLEEVKRKRDLEERARERNPGAALLTNERSSASDR
AFAEAIREKFALDEDNDQDILDQHVSRVWKDQTPHRSPGTMSPCPPIPSRRRTATHDSGM
VSDGAMSLSGHSMKHSKSMPDHSSCSRKLTNKWPSMNTDSGISMFSADTVTKYKDASSRS
GSSTASKLEEAKRRLEDEPRRSRRYAQPPMQHLSQQPLASFSSSSSGGSISLPHQPPPLP
AKPPETIVVFSFCEEPVPYRIKIPGTQPTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQ
EEIVNDSDILPLFGDKAMGLVKPSD
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccatccatcgggaatccggaaacatgatgataatgagtgtagtggcccacga
ccaccagtacccggagaagagagccgtgttaaaaagatgaccgaaggggtagcagatacc
tcgaagaattcgtcgccatcctacctgaactgggcccggacgctgaaccacctgctggag
gaccgcgatggggtcgagctctttaagaagtacgtggaggaggaggcgcccgcctacaac
gaccacctcaacttctacttcgcctgcgagggcctcaagcagcagacggatccggagaaa
atcaagcagataatcggagccatctacagattcttgcgcaagagtcagctgtccatctcc
gatgacctgcgcgcccagatcaaggccatcaagacgaatcccgagatcccgctcagccca
cacatattcgatcccatgcagcgccatgtggaggtcaccatccgcgacaacatctacccc
acgtttctctgctccgagatgtacatcctctacatccagcagatgtccgcccagcaggag
cgctgcaccagcagcggcgccacgggatcgggaagtgccgggagtagtggcagcggcggc
agcagcctagcgggtgcctgtgccctgccaccgaccaccgcgtccggcaagcagcagctc
ccgcagctggtgccgcccggtgccttcatcaacctgccggtgagcagcgtgagcgggccg
ccagctggcacgtgcagtgccagcggcagtgtgtacggtccctcgacttcggccagctcc
agcggctcaataagcgccaccgacacactgccccgcagctccacgctgcccacgctgcac
gaggactcggtgctgtcgctctgcgacgacttcgagaaggtgcagatgcaggagggcggc
ggatccctcggctctggatctgtgggcgcgggtgcgcgagcgcccgactacccgattcgc
ctcacgcgggacctactaatagcaactcagaaaagaagactggaaatccgacctcctggt
gcccacggttacgtgtacaatccaagcactaccaacacctcctatgtgccgaattcgcgg
gttgattcggagagggccagcgttagctccggcgggcgcaccgactccgacaccatgtcg
atctccagctgttccatggacggtcgcccgtacatccaacgcagacacagctccacggag
agcaaggcgatccgccagagcgcgatggcaaacaaggagaccaacacctttcaggtgata
cctcgcacacaacgactacattcgaacgagcacagaccactgaaggaagaggagctggtg
tccttgctgatacccaagttggaggaagtgaagcgaaagcgagacctggaggaaagagct
cgcgagagaaatcccggtgctgctctgcttaccaacgaaagatccagtgccagcgatcga
gccttcgccgaggcgatacgagagaagtttgcactggacgaagacaacgaccaagacatt
ctggaccagcatgtgtcgcgggtgtggaaggaccaaacgccgcaccgctcgccgggaacg
atgtcgccctgcccacccataccgtcgcgccgacgtacagccacccacgattccggaatg
gtcagcgatggcgccatgagtctaagcggacactcaatgaagcactcaaagtccatgccg
gatcacagttcctgctcgaggaagttgacaaacaaatggccttccatgaacacagacagt
ggcattagcatgttctcggccgacactgttaccaagtacaaagatgcgagttctcgatct
ggctctagcacggcctcgaaactggaggaggcgaaacgaagactggaagacgagccgcgg
cgctctcgtcgatacgcccaaccgccgatgcagcacctgtcgcaacagccactggcctcc
ttcagcagcagcagcagtggcggcagcatcagcctgccacaccagccaccgcctctgccg
gccaagccgccggagacgatcgtggtgttctcgttctgcgaggagccagtgccgtacagg
ataaaaatacccggtactcagccaaccctgcgtcagtttaaggactatctgcccagaaga
ggtcactttaggttcttcttcaagacgcactgcgaggacccggacagtccagtgattcag
gaagagattgttaacgactccgacatactgccgctattcggagacaaagcgatgggtctt
gtcaagccatccgattaa

DBGET integrated database retrieval system