KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7955
Entry
Dmel_CG7955       CDS       T00030                                 
Symbol
ABCB7
Name
(RefSeq) ATP binding cassette subfamily B member 7, isoform A
  KO
K05662  ATP-binding cassette, subfamily B (MDR/TAP), member 7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dmel_CG7955 (ABCB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG7955 (ABCB7)
Transporters [BR:dme02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    Dmel_CG7955 (ABCB7)
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_16 DUF799 AAA_29 DUF87 FtsK_SpoIIIE ABC_ATPase DUF815 AAA_22
Other DBs
NCBI-GeneID: 38193
NCBI-ProteinID: NP_728642
FlyBase: FBgn0035244
UniProt: Q9W0C5
Position
3L
AA seq 743 aa
MAGLLHLTKQCSIHLPAHLGRAKCYTLAKGPGTHVQARVLYSSLTKVDDKNSSDAKRKKI
TPFTPTPGSKLLGGVFGKKAKGGAPAAAAAKTTTLQRQRPYRPQQQQSRLCHVHIGGGSD
GGSGLGKLDAPEVTSKDMLRAMMAYIWPKEDPLVRKRVGISLGLLAGSKLLTVCVPFLFK
GAVDTMTTLNMDTAPDAVLSAATALMLGYGIARASAAGFNELRNAVFAKVAHHSIRKIAS
NVFLHLHNLDLAFHLNKQTGALSKTIDRGSRGINFVLSAMVFNIVPTIFELALVSSILGV
KCGLAFAGVSMGCVGIYAAYTLSVTQWRTQFRVFMNQAENEAGNKAVDSLINYETVKYFN
NEKYEAGCYNEVLKKYEAASLKTSSSLALLNFGQNAIFSSALSLIMVLAAKEIAQGNMTV
GDLVMVNALLFQLSIPLGFLGSVYREVRQALLDMRAMFTLMNVDSSIQTAANAQPLFVDT
TNSSIEFRNVSFEYEPGKPIFRDLSFTIPAGKNVAIVGGSGSGKSSMVRLLFRFFEPNSG
KVLIGGQDISAVDLESLRKVIAVVPQDSVLFHNTIEHNIHYGNLSKSHAEVQNAARMADL
HDSIMSWPGQYSTQVGERGLKLSGGEKQRVAIARAILKNTPILIFDEATSSLDSITEHNI
LQALTRATSGRTSICIAHRLSTVKDADEILVLENGRVGERGTHSELLRQNGLYARLWETQ
TQQFDPSREINEEVAAKKTRGVA
NT seq 2232 nt   +upstreamnt  +downstreamnt
atggccggactccttcacctgaccaagcagtgcagcatccacctacccgcccacttggga
cgcgcgaaatgctacacactcgctaagggaccgggaacacacgtgcaggcaagagtgctg
tactcttcgctgactaaggttgatgataagaacagcagcgatgccaagcggaagaagatt
accccgtttacgcccacgccgggtagcaagctcctgggtggagtattcggcaagaaggcc
aaaggtggagccccagcagcagcagcagcaaaaacaacaacgctacagcggcagcgacct
taccgcccacaacaacagcaatcacgactatgtcatgttcatatagggggcggcagcgat
ggtggctcgggattgggcaagctagacgcgccggaggtcacctccaaggatatgctgcgt
gccatgatggcctacatctggccaaaggaggatccactggtgcgaaagcgggtgggtatt
tccctgggtctgttggctggctccaagctgctgaccgtctgtgtccccttcttgttcaaa
ggagctgtggacacgatgacaacgctgaacatggacactgccccggatgcggtcctctcc
gcagccaccgcactgatgttgggatatggcattgctagagccagtgcggcgggctttaat
gagttgcggaatgcagtgtttgccaaggtggcccaccactcgatccgaaagatcgccagc
aatgtgttcctgcatctgcacaacctggatctggccttccacctgaacaaacaaactgga
gcactgtcaaagaccatcgatcgaggatcgaggggcattaactttgtgctctccgccatg
gtcttcaacattgtgcccactatctttgagctggccctcgtgtccagtatcctgggagtg
aagtgtggcctggccttcgctggtgtcagcatgggctgcgttggcatatacgctgcctac
actctgagtgtgacccagtggcgcacccagttccgtgtatttatgaaccaggcggagaac
gaggccggcaacaaggccgtagactcgctgatcaactacgagacggtgaagtacttcaac
aacgaaaagtacgaggcgggttgctacaacgaggtgctgaagaagtatgaggcggccagc
ttgaagactagctccagtctcgctctgctcaactttggccagaacgccattttcagcagc
gcactgagtctgattatggtattggccgccaaggagattgcccaaggcaacatgacggtt
ggagatttggtgatggtcaacgccctgctcttccagctctcgatccccctcggttttctg
ggcagtgtttatcgtgaggtgcgacaggctttgctggacatgcgggccatgttcacgttg
atgaacgtggacagtagcattcagacagccgccaatgcccagcccctgttcgtggacacc
actaactcatccattgagttccgcaacgtgagcttcgagtacgaacctggcaagcccatt
ttccgggacctcagtttcaccatacccgccggtaaaaacgtcgccattgtgggcggctct
ggctcaggaaaatcgtcgatggtgcgccttctcttccgcttctttgagccaaactctggt
aaagtgttgatcggtggccaggatatcagcgccgtggatttggagagcctgcgcaaggtt
attgcagtggtgccgcaggattcggtgctattccacaacaccatcgagcacaatatccac
tatggcaacctgtccaagtcccacgcagaagtgcagaatgctgcccgcatggctgatttg
catgactccatcatgagctggccaggacagtactccactcaggtaggcgaacgtggatta
aagttatccggtggcgagaagcagcgcgttgccatcgctagggccatactgaagaacacc
cccattctgatctttgacgaggctacaagcagtctggactcgatcaccgagcataacatt
ctgcaggctctgacccgcgctacctcaggacgcactagcatttgcattgcccaccgtctc
tcgacagtcaaggatgcggacgagattctggtgctcgagaacggacgtgtaggtgaacgt
ggcacccattcggagctgctgaggcagaatggactgtatgcccgcctctgggagacgcag
acgcagcagttcgacccgagccgggagatcaatgaggaggtggcagcgaagaagacgcgg
ggcgtggcgtag

DBGET integrated database retrieval system