KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7979
Entry
Dmel_CG7979       CDS       T00030                                 
Symbol
Uxs
Name
(RefSeq) UDP-xylose synthase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00520  Amino sugar and nucleotide sugar metabolism
dme01100  Metabolic pathways
dme01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG7979 (Uxs)
Enzymes [BR:dme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Dmel_CG7979 (Uxs)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 KxDL adh_short
Other DBs
NCBI-GeneID: 38911
NCBI-ProteinID: NP_648182
FlyBase: FBgn0035848
UniProt: Q9VSE8
Position
3L
AA seq 441 aa
MTATKKRLKIVAAISLLLLLLVYLYRMASFCPSGKVAVSVPGVEEVQAKWPPTESPLQRS
LQMAYEEQSSLIREQKAELQRTRENLARLEEQVRSLQTSTPRKYPKVKYLNYKNRKRILI
TGGAGFVGSHLVDDLMVQGHEVIVVDNFFTGRKRNVEHWLGHENFELIHHDIVNPLFIEI
DEIYHLASPASPPHYMYNPVKTIKTNTMGTINVLGLAKRVMAKVLIASTSEVYGDPTVHP
QPETYWGHVNPIGPRACYDEGKRVSETLSYAYAKQEKVQVRVARIFNTYGPRMHMNDGRV
VSNFILQALRNETITVYGNGKQTRSFQYVSDLVDGMIALMASNYTQPVNLGNPVEQTIGE
FAEIIKKLVGGPSVIKQSKAMEDDPQRRKPDITRARQLLHWEPKVPLETGLQRTISYFRN
ELARSDRFQESSNKYFDTHTP
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgactgccaccaaaaagcgtctgaagatcgttgcagccatctcgctgctcctcctgctc
ctggtctacctttaccgaatggccagcttctgcccaagcggaaaggtcgccgtttccgtt
cccggcgtcgaggaggttcaggccaaatggccgcccacggaaagtccgctacaaaggagc
cttcagatggcgtacgaggagcagagctctcttattcgagaacaaaaggccgaactccag
cgcacaagggagaatttggccagattggaggaacaagttcgtagcctccagaccagcaca
ccgcgcaagtatccgaaggttaaatacctgaactataagaatcgcaaacgcatactaatt
accggaggagctggcttcgtgggctcccacttggtcgacgatctgatggtccaggggcac
gaggtcatcgtggtggacaatttctttacgggacgcaagcgaaatgtcgagcactggctg
gggcacgagaacttcgagctcatccaccacgacatagtgaatccgcttttcatcgagatc
gatgagatctaccacttggcatcgccagcctcgccaccgcattacatgtacaatccggtg
aagaccatcaagaccaacaccatgggcacgatcaatgtactgggtctggccaagcgcgtg
atggccaaggttttgatagctagcacttcggaagtgtacggcgatcccacagtgcatccg
cagccagaaacatactggggacatgtaaaccctattggaccgagagcctgttatgacgag
ggaaagcgtgtctccgagacgctgagctatgcgtatgccaaacaggagaaagtgcaagtc
cgagtggcgcgcatctttaacacttatggaccgagaatgcatatgaacgatggacgagtg
gtgtcaaactttatacttcaggcgctgaggaatgaaaccattacggtgtatggaaatggc
aaacaaacgcgctcctttcagtatgtttcggatctggtggacggaatgatagccctaatg
gcatccaactacacacagccggtgaatttaggcaatcctgtggagcagacaatcggcgaa
tttgccgagatcatcaagaaactggtcggcgggcccagtgtgataaagcaatcgaaggcc
atggaagatgatccgcagcgcagaaaaccggacataactcgagcccgccagttgctccat
tgggagccaaaggttcccctagagactggacttcagcggaccatctcctacttccgcaac
gaattggcgcgtagcgatcgctttcaggaaagctccaacaagtactttgatacacataca
ccgtag

DBGET integrated database retrieval system