KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8098
Entry
Dmel_CG8098       CDS       T00030                                 

Symbol
Picot
Name
(RefSeq) picot, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-GeneID: 36865
NCBI-ProteinID: NP_725600
FlyBase: FBgn0024315
UniProt: Q9V7S5 D6W4V4
Position
2R
AA seq 529 aa
MPFRRSSLNHRHRDGHVLVWNQRNLHESLEQQPQRCFATRYFVTFMLFLGMANAYVMRTN
MSVAIVAMVNHTAIKSGEAEEYDDECGDRDIPIDDSQDGEFAWSSALQGYILSSFFYGYV
ITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIV
PCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIV
GTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPPIPFKAIIKSLPFYAIL
FAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISS
KRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHL
DLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGT
FYNIFGSGERQYWDNPEDDEQKPALQTTVTTSPARLSNGSTAPAAISSS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgccctttcgacgcagcagtctgaatcatcggcatcgcgatggccatgttttggtatgg
aatcagaggaatctccacgaatctctggagcaacagccgcagagatgctttgccacccgg
tactttgtgacctttatgcttttcctgggcatggccaatgcctatgtgatgcgcaccaac
atgtcggtggccattgtggccatggtgaaccacacggccatcaagtctggagaggcagag
gagtacgatgatgagtgcggagatcgggatattcctattgatgactctcaggatggcgag
ttcgcctggagctcagctctgcagggctacatcttgtcgtccttcttctatggctatgtc
atcacccagattccctttggcatattggccaagaagtacggttccctgcgcttcctcggc
tacggcatgttgatcaactccgtgtttgccttcctggttccggtggctgcccgcggtgga
ggtgtttggggtctgtgcgccgtgcgtttcatccaaggtctaggtgagggtcccatcgtg
ccctgcacccacgccatgttggccaaatggattccgcccaacgaaaggtcacgaatgggt
gccgccgtgtatgcgggtgcacagtttggaaccatcatctctatgccactttccggcctg
ctggctgaatacggattcgatggcggctggccgtcgatcttctatgtgtttggaattgtg
ggtaccgtctggtccatcgccttcctgatcttcgtgcacgaggatccctcttcgcatccc
actattgatgagcgcgagaagaagtacattaacgattccctctggggaactgatgttgtt
aagagccctcccattcccttcaaggctatcatcaagtcgctgcccttctacgccattctg
ttcgcccacatgggtcacaactacggctatgagactctgatgaccgagctgcccacctac
atgaagcaggtgctccgcttctccctgaagtcgaacggtctgctcagctccctgccctac
ttggccatgtggctcttctccatgttcatctcggtggtcgccgattggatgattagctcg
aagagattctcgcacacggccaccaggaagctgatcaacagtattggccagtatggaccg
ggagtcgccctaatcgccgcctcctacacgggctgcgacagagcactgaccttggccatc
ctcaccatcggagtgggtcttaatggaggtatctactccggcttcaagatcaaccacttg
gacctcacaccgcgtttcgccggcttcctaatgtcgatcactaactgctctgccaatttg
gctggtctcttagcgcccattgctgcaggtcacctcatttctgatcccagcaagcccatg
atgggtcagtggcagatcgtgttcttcatcgctgcctttgtgtacatcatttgcggtacc
ttctacaacatcttcggatccggtgagcgtcagtactgggacaatccggaggacgatgag
cagaagccggccctccagacgaccgtcaccacctccccagcgaggctgagcaacggcagc
acggcaccagcggccatctcgagttcctag

DBGET integrated database retrieval system