KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8384Help
Entry
Dmel_CG8384       CDS       T00030                                 

Gene name
gro
Definition
(RefSeq) groucho, isoform E
  KO
K04497  groucho
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04310  Wnt signaling pathway
dme04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG8384 (gro)
   04310 Wnt signaling pathway
    Dmel_CG8384 (gro)
   04330 Notch signaling pathway
    Dmel_CG8384 (gro)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ
Motif
Other DBs
NCBI-GeneID: 43162
NCBI-ProteinID: NP_996298
FlyBase: FBgn0001139
UniProt: P16371
Position
3R
AA seq 730 aa AA seqDB search
MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQ
RHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQE
LNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPP
EHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGE
KSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGS
SSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQR
PADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVP
FPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNP
VSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYAL
AISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTV
RSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESC
VLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGD
KKATVYEVIY
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtatccctcaccggtgcgccaccccgccgccgggggaccaccacctcagggtccaatc
aagttcaccatcgccgatacactggaacgcatcaaggaggagttcaacttcctgcaggcg
cagtaccacagcattaaattggagtgcgagaagctgtcgaacgagaagacggagatgcag
cgccattatgttatgtactacgagatgtcctatggccttaacgtggagatgcacaagcag
accgagatcgccaagcggctgaacacactgatcaaccagctacttccattccttcaggcc
gaccaccagcagcaagtgctgcaggcggtggagcgggcgaagcaggtgaccatgcaggag
ctcaacctgatcattgggcatcagcagcaacatggaattcagcaacttttacaacagatc
cacgcccagcaggtgccaggtggaccacctcagccgatgggcgcactgaatccgtttggc
gccctgggcgccaccatgggcctgccacacggaccgcaaggtctgctgaacaaaccgccc
gaacaccacaggccggacatcaagccgacgggtctagaggggccagcagccgccgaggag
cgattgcgcaattcggtttcgccggccgatcgtgagaagtatcgcacacgctcgccgctg
gacatcgagaacgactcgaagcgtcgaaaagatgagaaactgcaagaggatgaaggcgag
aaaagcgatcaagatttagtcgtagatgttgcaaatgaaatggaatcccactcaccgcgt
cccaacggcgagcacgtgtctatggaggtgcgcgatcgggaaagcttgaatggcgagcgc
ctggagaagccaagcagtagtggcatcaagcaggaacggccgccctcacgctccggctcc
agttcgtcacgttccacacccagcctcaagacaaaagatatggaaaagccgggtacaccg
ggcgccaaggcacgcacaccgacaccgaacgccgctgctccggcgccaggcgttaatcct
aaacaaatgatgccgcagggaccaccgccagccggatatccgggtgcaccgtatcaaagg
ccggccgatccctaccagcgtccaccgtcagatccagcctatggacgaccgccaccaatg
ccgtacgatccgcacgcccatgtgcgaaccaatggcattccacatccctcggccctaacg
ggtggaaagcctgcatactctttccatatgaacggcgagggtagtctacaaccggtgccg
ttcccgccggacgcgttggtgggtgttggaattccgcggcacgcccgtcagatcaacacg
ctgtcgcatggagaggtcgtctgtgcggtaaccatctctaatcccacaaagtacgtgtac
acgggcggcaagggctgcgtcaaggtatgggacatctcgcaaccgggcaacaagaatcca
gttagccagctggattgtctgcagcgcgacaactacatccgctcggtgaagctgctgccc
gacggccgtacgctgatcgtgggtggtgaggcgtccaacctgtctatctgggatctggcc
agtccgacgcctcgcataaaggcggaactaacatcggcggcgcccgcctgctacgctctg
gccattagccctgactcgaaggtgtgcttctcgtgctgcagcgacggcaatatcgctgtg
tgggacctgcacaacgagatcctggtgcgccagttccagggccataccgacggcgcttca
tgcatcgacatcagtccggatggctccaggctgtggacgggcggcttagacaacacggtg
cgctcctgggatctgcgcgagggtcgccagctgcaacagcacgacttcagctctcaaata
ttctcgctcggctactgtcccacaggcgactggctggctgtgggtatggagaactcgcat
gtggaggtgctgcacgcatcgaaaccggacaagtatcaactgcatctgcacgagagctgc
gttctgtcgctgcgctttgccgcctgcggcaaatggttcgtttccaccggcaaagacaac
ctgcttaacgcatggcgaacaccttacggtgccagcatattccagtcgaaggaaacatca
tccgtacttagctgcgacatatcaactgacgacaaatacattgtgacgggttcgggcgat
aagaaggctactgtctacgaagttatttattaa

DBGET integrated database retrieval system