KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8403
Entry
Dmel_CG8403       CDS       T00030                                 

Name
(RefSeq) SP2353, isoform B
  KO
K24341  pikachurin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dme04990]
    Dmel_CG8403
Domain-containing proteins not elsewhere classified [BR:dme04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   Dmel_CG8403
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 EGF FXa_inhibition Prokineticin
Other DBs
NCBI-GeneID: 36771
NCBI-ProteinID: NP_001286474
FlyBase: FBgn0034070
UniProt: A1ZA87
Position
2R
AA seq 1361 aa
MSTSKHHHHHCRVVCVWLLLVLSSLSSASIAVGAIPEPEEAAFQGHCGHTSPCEQLCYEI
HDGMYECDCIEGYELNKNGYSCQVINATSNSLDGRGKSDEDVLYQKGASFSAKLANDDGG
KSMAKSTFALSAAQSASPAGNENGEDESGSEGDSYDYGELEDSNSETQEQKQKSLNLQQQ
QQQQQKVNSNDYYISAESINFNSESEGQEQQDVADFKAASTMLPSSVPPTPSRSTTRATA
STTTTTTTTRRSPTRAPKQRVDVDYGEGDGSDDYSYSYKSDMSVYDDVNNNQLNLRRNSK
SQTYQQTSNTNTAKNRRKYPNVTSNKVQMHITRETNRLENISAAEPAVVGAAMTTDRSTP
TCNLDCGSDGICALEATAASSRCLCPFGKTGNGCQEDIRAHVPRFAKRSWLAFPALHGAY
KHVQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRETI
LLNEWNSVIIYRHRWDAWLVLNHGTKVQGRSNGLFSRITFREPVFLGGIGNITGLAKRLP
LAEGFAGCIRRFVANEHDYKFTEHPLGDVINGFDIQDCSTDKCVRYPCQHGGKCLPSDQG
AICLCPIGFVGDLCEIRMDLQVPAFNGSSFLRYAPLGDSALIWLELKVTLKPEQADGLIL
YSGPEHRGDFIALYLNDGFVEFAFDLGSGPALVRSEHSLSLGQWHTIKISRTARLAVLKV
DKHQEVLTISSNGFWHLSLDQNLFVGGVNHVDRLPLDLKYKPFFVGCIQRIDINGHSLGI
VAEALGGSNIGNCPHACVARPCGPLAECVPQMESYECRCSIHNERCNKAAEVPPEQLPEL
ALHKSKVLETKDNGEAAKKVSGLAHKKHSKKHRNLHKPTPATSTTTSTTSTTTTTTEAPS
ERTEEATAGALSNEEIEDDIIFRLVQQQQQQKELKKQHQQTTTTAPATSTTSSGPSKAKP
RLSGKHHASKHEHHLKPNAAFTRKLSRLPTHYESFQTNPDSDILTFEDNNDWVTSLQQQE
YGDAMAASQVPLAFEDASPGTPRSSDNNEDDENAFVFDESLFDASDGTEEYQRKQLAQDM
KRIMSNSNAHSSHKKAEVQFPPQGSQEVGTANEDTSQYSDDYNDDELLTPVMQGGEEVKL
EQHTSSTPQTHTDWSLLKKFDLSAEHQSQVQGVRKNFGACFAGSDSYFHYNDADTMSQVI
SYSIDLNLRIKTHSENGVILWTGRQGTTEEHDDYLSLGIEQGYLHFRYDLGSGEVDIRFN
GTKVSDGLWHRVRAIRNSQEGYLEVDGRKTVTLRAPGKLRQLNTDTGLYVGGMPDVGYFT
HQRYFSGIVGCISEIVLAGEMKLNFDPNTLGTEHNVETGLL
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgtcaacttcaaagcatcaccatcaccattgccgagtcgtctgcgtgtggctcctcctg
gtgctatcatcactatcgtcggccagcatcgctgtgggtgcgatcccggagccagaggag
gcggcctttcaaggccactgtggacacaccagcccctgcgaacaactatgctacgagatc
cacgatggaatgtacgagtgcgactgcatcgagggctacgagctgaacaagaacggttac
agctgtcaagtaattaacgccacatccaacagtttggatgggcgtggcaagtcggacgag
gatgtgctctaccagaagggcgcctcgttcagcgccaaattggcgaacgacgatggtggc
aagtcgatggccaagtccacgttcgccctatccgccgcgcaatccgcatcgccggcgggc
aacgaaaatggggaggatgagtccggatccgagggcgacagctacgattacggcgagctg
gaggacagcaactcggagacacaggaacagaagcagaaatcgctgaatcttcagcagcag
cagcaacagcaacaaaaagtcaattcaaacgattactacatatcagcggagagcatcaac
ttcaattcggagtccgagggccaggagcagcaggatgtggccgacttcaaggcggccagc
acaatgctgcccagctcagtgccacccactcccagcagaagcacgacaagggcaaccgcc
agcacaaccacaacgaccacgaccacaaggcgatcccctaccagggcgcccaagcagcga
gtggatgtggactatggcgagggtgatggcagcgatgactatagctacagctataagtcg
gacatgtccgtctacgacgatgtcaacaataatcaattaaacttaagacgcaacagcaaa
tcgcaaacatatcagcagacaagcaataccaacacggccaagaaccgcaggaagtaccca
aacgtaaccagcaacaaggtccaaatgcatatcacgagggagaccaaccgacttgagaac
atatcagcagcggaaccggctgtcgtgggagcagccatgacaacagacaggagcactcct
acatgcaatctggattgcggttccgatggaatctgtgccttggaggcaactgccgccagt
tctcgttgtctttgtccctttggcaaaacgggcaatggctgtcaggaagatattcgagcc
catgttccgcgtttcgccaagcgatcctggctagcatttccggcgctccatggcgcctac
aagcacgtccaattgcgcatcgaattccgtccagagtcctttgacggcattatcctgctg
agcggagagcgcgatgacctcaccggtgactttatggccctgctactaaacaagggcttc
gtggagttctggtttgattgtggttccggtgtgggcagcgttcgatcccgggagaccatt
ctgctaaacgaatggaactcggtgatcatctaccgtcatcgatgggatgcctggctggtg
ctcaatcatggcaccaaggtccagggaagatcgaatggattgttctcacgcatcactttc
cgggagccagtttttctgggtggaattggcaacataactggattggccaagcgtcttcct
ctggccgagggtttcgccggctgcattcgtcgttttgtggccaacgaacatgactacaag
ttcacagagcatcccttgggcgatgtcatcaatggattcgatatacaggattgttccacc
gacaagtgcgtgaggtatccttgccagcatggtggcaagtgtttgccctcagatcagggc
gccatatgcctatgtcctataggatttgttggtgatctgtgtgagattcgaatggatcta
caggttcccgccttcaatggctcatctttcttgcgctacgctccactgggcgatagtgcc
ctcatttggttggagctaaaggtgacccttaagcccgaacaggcagatggcttgatactg
tactcgggtccagagcatagaggtgactttatagctctgtacctcaacgacggatttgtg
gagtttgccttcgatctgggcagtggtccagctttagtgcggagcgaacattccctcagt
ctgggtcaatggcacaccatcaagatctctcgaacagctcgtctggcggtgctcaaggtg
gataaacatcaggaggttttgactatttcatcgaacggcttttggcacttgtcgctggac
cagaatctctttgtgggcggcgttaaccacgtggaccgtctgcctttggacctcaagtac
aaacccttcttcgttggctgcatccagaggatcgacatcaatggccactcgctgggcatt
gtggcggaggcattgggtggcagcaacatcggcaactgcccccacgcttgtgtggcacga
ccctgcggccccctggcggagtgcgtgcctcaaatggagagctacgagtgccgctgcagc
atccacaatgagcgctgcaacaaggccgccgaggtgccgcccgagcagctgcccgagctg
gctctccacaagtccaaggtcctcgagacgaaggacaatggagaggcggcgaagaaggtg
tctggcttggcgcacaagaagcattccaaaaagcacaggaatttgcataagccaacccct
gccacgagcacgaccacaagcaccacctcaaccaccaccacgaccactgaagctccttct
gagaggacagaggaagccactgcgggggcgctaagcaacgaggaaatcgaagatgatatc
atattccgtcttgtgcagcaacaacagcagcagaaggagctcaagaagcagcaccagcag
acgactactactgccccagccacctcaaccacatccagtggtccatctaaagcaaagccc
aggctttcagggaagcaccatgccagcaagcacgagcaccatctgaagcccaatgctgcc
ttcacccgcaagctgagtcgcctgcccacccactacgagagtttccagacgaaccccgac
agcgatatccttaccttcgaggacaacaatgactgggtgaccagtctgcagcagcaggag
tacggcgatgccatggcggccagtcaggtgccattggcctttgaggatgcaagtcccggt
actcccaggtctagtgacaacaacgaagatgatgagaatgcctttgtgttcgatgagtcg
ctttttgacgcttccgatggaacggaggagtaccagcgcaagcaactggcccaggatatg
aagcgcatcatgtcaaattcaaatgcgcactccagtcacaagaaggcagaggtccagttt
ccacctcaaggcagtcaagaagttggtaccgccaacgaagacacctctcagtacagcgat
gactacaacgatgatgagcttttgacgccagttatgcaaggcggtgaggaagtcaagctg
gaacagcatacctccagcacaccgcagacccacaccgactggagtcttctgaagaagttc
gacctgtccgccgagcaccagtcgcaggttcagggcgtacgcaagaatttcggagcttgc
ttcgccggcagcgatagctatttccactacaatgacgcggacaccatgagccaggtgatc
agctacagcatcgatctcaatctgcgcatcaagacgcactcggagaacggcgtgattctg
tggacgggacgccagggtacgacggaggaacacgacgactacctctcgctgggcatcgaa
caggggtacttacacttccgctatgacttgggatctggtgaggttgatatccgcttcaat
ggcaccaaggtcagcgatggtctgtggcatcgcgtgagagccataagaaactctcaagag
ggctatctggaggtggatggcagaaagacagtcactttgcgggcgcctggtaaactccgc
cagcttaacacggacaccggtctgtatgtgggtggaatgcccgatgttggttacttcacg
caccagcgctacttcagtggcatcgtcggctgcatctcggaaatcgtcctggccggcgaa
atgaaactgaacttcgatcctaatacgctgggaacggagcacaatgtggagacgggcctc
ctatga

DBGET integrated database retrieval system