KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8428
Entry
Dmel_CG8428       CDS       T00030                                 

Symbol
spin
Name
(RefSeq) spinster, isoform C
  KO
K23677  MFS transporter, Spinster family, sphingosine-1-phosphate transporter
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG8428 (spin)
Transporters [BR:dme02000]
 Major facilitator superfamily (MFS)
  Lipid transporters
   Sphingosine-1-phosphate transporter (Spinster) family [TC:2.A.1.49]
    Dmel_CG8428 (spin)
SSDB
Motif
Pfam: MFS_1 OATP Sugar_tr
Other DBs
NCBI-GeneID: 45380
NCBI-ProteinID: NP_725530
FlyBase: FBgn0086676
UniProt: Q9GQQ0
Position
2R
AA seq 605 aa
MSLKHQKQSYQPLPTAAAMDNPAMIQSSGSSGSSSSEEGGSREDVANLSPLGLPTTYSSQ
QLMPSDTDSMEEERHRLRPHHHHHHPLGEHHHIPGIPPSAVVPSRLSSVGRSQWFTVTVL
CFVNLINYMDRFTIAGVLTDVRNDFDIGNDSAGLLQTVFVISYMVCAPIFGYLGDRYSRP
WIMAVGVGLWSTTTLLGSFMKQFGWFIAFRALVGIGEASYSTIAPTIISDLFVHDMRSKM
LALFYFAIPVGSGLGYIVGSKTAHLANDWRWALRVTPILGIVAVFLILLIKDPVRGHSEG
SHNLEATTYKQDIKALVRNRSFMLSTAGFTCVAFVAGALAWWGPSFIYLGMKMQPGNENI
VQDDISYKFGLVAMLAGLIGVPLGSFLAQRLRGRYENCDPYICAVGLFISAPMVFAALVV
PQTSESLCFFFVFVAQVALNLCWSIVADILLYVVVPTRRSTAEAFQILISHALGDAGSPY
LVGAISEAIMKHLHKNPSDSGLTTELRSMSQVAGSAISNATQVIAEATTSLMETARSSAS
QEYSDVEQFEGLQYALFSTSFVEVLGGIFFIFTACFIIKDKYNATRGLQDATAQQQQRDE
RGQIA
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgtcgctgaaacaccagaagcaatcctaccaaccgctcccaacggcggccgccatggac
aatccggcgatgatccagagcagcggtagcagtgggagcagctcctctgaggagggcggg
agtcgtgaggatgtggccaatctatcgccgctcggactgcctacgacctactcgtcacag
caattgatgccctcggatacggacagcatggaggaggagcggcaccgactgcgtccccac
caccatcaccaccacccactgggcgagcaccaccacatcccgggcataccaccatccgcc
gtcgtgccatcgcgtctctccagcgtgggcagatcgcagtggttcaccgttaccgtgcta
tgcttcgtcaacctcatcaactacatggatcgctttacgatcgcaggagttctcacagat
gtccgaaatgatttcgatattggcaatgatagtgccggacttctccagacggtcttcgtt
atctcgtacatggtatgcgcccccatcttcggctatctgggcgatcgttactcccgcccc
tggataatggcggtgggcgtgggtctgtggagcaccaccaccctactggggtcgttcatg
aagcagtttggatggttcatcgccttcagagcgctggtcgggatcggcgaggcatcgtac
agtaccatcgcaccgacgattatctcggatctgttcgtgcacgacatgcgctccaagatg
ctggcactgttctactttgccatacccgtgggatccggtctgggatacattgtgggatcc
aagacagcgcacctggccaacgattggcgctgggctctgagggtcacgcccattctgggc
attgtggcagttttcctcattttgctgatcaaggatccggtgcggggtcacagcgaggga
tcgcacaatttggaggccactacctacaagcaggacatcaaggcgttggtcaggaaccgt
tccttcatgctctccacggctggattcacgtgcgttgccttcgtggccggagcactggcc
tggtggggaccttccttcatctatctaggcatgaagatgcagcccggcaacgagaacatt
gtccaggacgacatctcgtacaagtttggtctggtggccatgttggccggactcatcgga
gtcccgttgggctcctttctggcccagcgattgaggggtcgctacgagaactgtgatccg
tacatctgtgcggtgggacttttcatctcggctccgatggtcttcgctgctctcgtggtg
ccgcagacaagcgagagcctctgctttttcttcgttttcgtggcccaggtggcactgaac
ctgtgctggtccattgtagccgacatcctactgtatgtggtggttcccacgcgacgttca
acagccgaggccttccaaatcctcatctcacacgcactcggtgatgccggcagtccgtat
ttggttggagcaatctccgaggccatcatgaaacacctgcacaagaaccccagcgactct
ggactgaccaccgagctgcgaagcatgtcccaagtggcaggttccgcgatcagtaatgcc
acccaggtgatcgcggaagccaccaccagtttgatggaaacagcacgctcgtcagcctct
caggaatactctgatgtggagcaattcgagggactgcaatatgcgctcttctccaccagt
tttgtggaggtgctgggcggcattttcttcatattcaccgcctgctttatcatcaaagac
aagtacaatgccacacgaggactgcaagatgccacggctcagcaacagcagcgggatgag
cgcggtcagattgcctaa

DBGET integrated database retrieval system