KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8464Help
Entry
Dmel_CG8464       CDS       T00030                                 

Gene name
HtrA2
Definition
(RefSeq) HTRA2-related serine protease, isoform B
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG8464 (HtrA2)
   04215 Apoptosis - multiple species
    Dmel_CG8464 (HtrA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dme01002]
    Dmel_CG8464 (HtrA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG8464 (HtrA2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     Dmel_CG8464 (HtrA2)
Peptidases [BR:dme01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dmel_CG8464 (HtrA2)
Chaperones and folding catalysts [BR:dme03110]
 Other chaperones and cochaperones
  DegP / HtrA
   Dmel_CG8464 (HtrA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 Peptidase_S46 PDZ Tricorn_PDZ Hjc
Motif
Other DBs
NCBI-GeneID: 41756
NCBI-ProteinID: NP_001262565
FlyBase: FBgn0038233
UniProt: Q9VFJ3 A0A0B4KG52
Position
3R
AA seq 422 aa AA seqDB search
MALRGSHRLEVIFKRCIASPVLHSHAANRRSSQLAIKEGDPNSNGNSGQYQQNGEQKEKG
WRRLVRFFVPFSLGAVVSAAIIQREDLTPTIAASKMTGRRRDFNFIADVVAGCADSVVYI
EIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPAT
IEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQR
ASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKV
FLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKV
IVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPE
DP
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcggttcccaccgcttggaagtgatcttcaaacgctgcattgcctccccg
gtgttacacagtcatgcagccaatcggaggagcagtcaactagcgatcaaagaaggcgat
ccaaacagcaatggtaacagtgggcaatatcagcaaaatggtgaacaaaaagaaaaaggc
tggagacgattggttcgattctttgtgcccttctccctgggcgctgtggtcagtgcggcg
atcatacagcgggaagacttaacgccaacgatcgccgcttccaaaatgaccggtcgtcgg
cgggacttcaactttatagctgatgtggtggcaggttgtgcggattcggtggtctacatt
gagattaaggacacccgccactttgactacttcagcggccaaccgattacggcatcgaat
ggttccggcttcattattgagcagaacggtctcatccttaccaacgcccatgtggtgatc
aacaaaccacacacaatggtacaggtgaggctatccgatggcaggacttttcccgccacc
atcgaggacgtggatcagacatccgatctggcgactttgcgcatacaggtgaacaatctt
tcggtgatgcggctaggcaagagcagtaccctgcgatccggcgagtgggttgtggcctta
ggcagtccgctggccctaagcaatacggtgacagcaggcgtaatcagttcaacgcagcgt
gcatctcaagaacttggccttcgaaacagggatatcaactacctgcaaacggatgctgcg
attacgtttggcaactccggcggtcccttggtcaatctggatggcgaggctattggagtt
aactcgatgaaggtgacggctggcattagcttcgcaatacccattgactatgtaaaggtg
tttctggagcgggcggccgagaaacgaaagaagggctcggcctacaagactggctatccg
gtgaagcggtacatgggcatcaccatgctgacgctcacaccggatattctgttcgagctc
aagtcacgaagccaaaacatgcccagcaacttaacgcacggcgtgctcgtgtggaaggtt
atcgttgggtcaccggcgcacagtggtggactccaacccggagacatagtgacccacata
aacaagaaggagatcaagaactcatcggatgtctacgatgccctggcggataatagtaaa
actctagatatagtgatcctgcgaggtgtgaagcagatgcacgtgaccattacgccagaa
gatccctag

DBGET integrated database retrieval system