KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8553Help
Entry
Dmel_CG8553       CDS       T00030                                 

Gene name
SelD
Definition
(RefSeq) Selenide,water dikinase, isoform A
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00450  Selenocompound metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dmel_CG8553 (SelD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dme03016]
    Dmel_CG8553 (SelD)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Dmel_CG8553 (SelD)
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Dmel_CG8553 (SelD)
 Prokaryotic Type
    Dmel_CG8553 (SelD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 36587
NCBI-ProteinID: NP_725374
FlyBase: FBgn0261270
UniProt: O18373
Position
2R
AA seq 398 aa AA seqDB search
MSYAADVLNSAHLELHGGGDAELRRPFDPTAHDLDASFRLTRFADLKGRGCKVPQDVLSK
LVSALQQDYSAQDQEPQFLNVAIPRIGIGLDCSVIPLRHGGLCLVQTTDFFYPIVDDPYM
MGKIACANVLSDLYAMGVTDCDNMLMLLAVSTKMTEKERDVVIPLIMRGFKDSALEAGTT
VTGGQSVVNPWCTIGGVASTICQPNEYIVPDNAVVGDVLVLTKPLGTQVAVNAHQWIDQP
ERWNRIKLVVSEEDVRKAYHRAMNSMARLNRVAARLMHKYNAHGATDITGFGLLGHAQTL
AAHQKKDVSFVIHNLPVIAKMAAVAKACGNMFQLLQGHSAETSGGLLICLPREQAAAYCK
DIEKQEGYQAWIIGIVEKGNKTARIIDKPRVIEVPAKD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgccgctgatgtgctgaactcggcccatttggagctccatggtggtggcgac
gccgagttgcgtcgtccattcgatcccacggcccatgatttggatgcatccttccgcctt
acacgcttcgcagatctaaaggggcgcggctgcaaagtgccgcaggatgtgctctccaag
ctggtgtccgccctgcagcaggactactctgcccaggaccaggaaccgcagtttctcaac
gtggccattccccgcatcggtattggcctggactgctccgtcattccgctgcgacacggc
ggactctgcctggtgcagaccaccgatttcttttaccccattgtcgatgatccctacatg
atgggcaaaattgcgtgcgccaatgtgctcagcgatttgtatgccatgggagtcacagat
tgcgataacatgctgatgctgttggcggtcagtaccaagatgacagagaaggagcgtgac
gtggtcattccgctgataatgcgaggctttaaggactccgctttggaggcaggcaccact
gtgactggaggccagagcgtggtcaatccgtggtgcaccattggtggggttgcctcgacc
atttgccagccaaatgagtatattgtgccagataatgccgtggtaggggatgtactggtg
ctaaccaagccactgggcacccaagtggccgtgaatgcccaccagtggattgaccagccg
gagcgctggaaccgcattaagctggtggtgtccgaagaagatgtacgcaaggcctaccac
cgggcgatgaactctatggctcgcctcaaccgcgtagccgctcgcctcatgcacaagtac
aatgcccacggagccaccgatattactggattcggactactaggccacgctcaaaccctg
gctgcacatcagaaaaaggatgtctcctttgttatccacaatctgccggtgatcgccaag
atggctgcagtggccaaagcctgcggcaacatgttccagctgctgcagggccactcggcg
gagacctcgggaggattactgatctgcctgccgcgagagcaggccgctgcttattgcaag
gacatcgagaagcaggagggctaccaggcctggatcatcggcatcgttgagaagggcaat
aagaccgcacgcatcatcgacaagccccgcgtcattgaggtgcccgccaaggactag

DBGET integrated database retrieval system