KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8610Help
Entry
Dmel_CG8610       CDS       T00030                                 

Gene name
Cdc27
Definition
(RefSeq) cell division cycle 27, isoform B
  KO
K03350  anaphase-promoting complex subunit 3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
Module
dme_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG8610 (Cdc27)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dmel_CG8610 (Cdc27)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dmel_CG8610 (Cdc27)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dmel_CG8610 (Cdc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_8 TPR_2 ANAPC3 TPR_16 TPR_11 TPR_12 TPR_14 TPR_17 TPR_7 TPR_19 TPR_9 SRP_TPR_like HrpB1_HrpK TPR_20 ChAPs
Motif
Other DBs
NCBI-GeneID: 38798
NCBI-ProteinID: NP_001261503
FlyBase: FBgn0012058
UniProt: Q9VS37
Position
3L
AA seq 900 aa AA seqDB search
MMIQEPVQAAIWHCLNYYDFKDAVFLSERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESALISTGFADAKNCDELQRDFGDLACFAYQLM
AQICMRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAAAIFQIHSTDVFNTCQG
SSVNANAMVLFGAEQQGQQHQERQSLITNLSNVSNYILTTPVDQQQQQINQNQNQHHNSN
MVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGAPQDPAGQYQQNQQLYDMS
SGTPFRKQFKYLSAISPPTPSFGIMPLTSPCTGNDGSFIGNHTPVMNISYSPMPQMLVEV
NQEPKMMGKKLKTHVGGLINRKEGSLNKPAVFTQAGNITPRTPNNNNVGNNGNMNVPPNP
NAAVRRSSRLFSNSYSVKENNKSPNIANKFVQPRSPPRKAKSRMTKICLNNELIEDKSHH
LSEKRKEKVETITSSGANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMGLKKQSADGLM
ALLRGLAEAYQLLSNFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAVAIF
ETIHKTEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWCVSGNCFSLQKE
HETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRDPRHYNAWYGIG
TIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQTLNTAATLDPKN
PLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLGNMDLALMHFSW
ATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQAQQDGSYDSDY
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcattgcctgaactactacgacttc
aaggatgccgttttcctgtcggaacgcctgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgctccaatcaggtgcaccaggcatattggctgctc
aaggagaaggcacgccgctcgccgcagtgccgctttctgcaggccaaatgtgcctacgag
ctgaaaaaatacgctgaggcggagagtgccctgatctccacgggattcgcggacgccaag
aactgcgatgagctgcagcgggacttcggggatctggcctgcttcgcctatcagctaatg
gcccagatctgcatgaggaccgagcgcaataaactggccgttagtgctttaaggcgcgcc
ctcaaactgaaccccttcatgtggcacgcattcgcggatctgtgcctgctgggccaggat
acagatgcggcggccatattccaaatccacagcacagatgtgttcaatacctgccagggc
agcagcgtaaatgccaatgcaatggtgctgttcggagccgagcagcagggtcaacagcat
caggagcgccagtcgctgatcaccaacctaagcaatgtctccaactacattctgaccacg
cccgtggatcagcagcaacaacagatcaaccagaatcagaaccagcaccacaacagcaac
atggtgacgcccatcaacaataataataataacaacaatctcaatagttcgatcagcatg
ctgcgcgggggtttggtacaaaactccagcatgctggcgatgctggaggacacacctatg
ggagctccgcaggacccggccggccagtatcagcagaaccagcagctctacgacatgagc
agcggtactccgtttcgcaaacagttcaaatacctatcggccatctcaccgccaacaccg
agcttcggcatcatgcctttaactagtccgtgcaccggcaacgatggatccttcattggc
aaccacacgcccgttatgaatataagctattcgccgatgccacagatgttggtcgaggtc
aaccaggagccgaagatgatgggcaaaaagctaaagacacatgtgggcggactcatcaat
cgcaaagagggcagccttaataaacccgccgtctttacgcaagccggaaacataacgccc
cgcactccgaacaacaataatgtgggcaacaatggcaatatgaatgtgccgcccaatccg
aatgctgcagtgcgtcgcagttcgcggctgttcagcaactcgtattcggtgaaggagaac
aataaatcgcccaacatagccaacaagttcgtgcagccacgttcgccgccccgcaaagcc
aagtcacggatgaccaagatctgcctaaataacgaactgatcgaggataagtcccaccac
ctctccgagaagcgcaaggagaaggtggagactattacttcctcgggagcgaataacaac
agcggtggacgcagtgccgccgaggaggccaaagtactgctgaacaatagcctaaacaat
gcccagacgatggcccaccagctgatgggactcaagaaacaatcggccgatgggctgatg
gccctgctgcggggtttagctgaagcctatcagctgctctcgaacttccagtgcaaggcg
gccataaagcagctggagacgacgataccaaagcaccacctgaactccagctgggtgcag
tcgctcatcggactggccaggtacgagatgcgtgagtatgaggcggcggtggcgatattt
gagaccatccacaagacagagccatgtcgcttggactacatggagatatactcgtcatcc
ctgtggcatttgcagcgcgaggttgagctgtcagctctcgcccaggatctgattaaccag
gacaaaaccagcccggttacctggtgtgtgtccggcaattgcttttcgctgcaaaaggag
cacgaaaccgcgatcaagttcttcaagcgggctgtccaagtggatccagacttcgtctac
agctacacactgttgggccacgaactcgtactcaccgaagaatttgataaggccatggac
tacttccgtgcagcagtggttagagatccgcggcattacaatgcttggtacggcatcggc
accatctactccaagcaggagaaatacgagctggctgagattcactacgtgaaggcgctg
aaaatcaatccacagaactcggttattctcgtgcacatcggcgccatgcaattctacatg
aagaagaaggatctgtcgctgcagacgctaaacacggccgccacgctggaccccaagaac
ccgctgacgcgattccatcgcggctccatctacttctcgctgggcaagtaccaggaggcg
ctgcgcgaactggaggagctcaaggaagtcgtgcccaaggagtcggtggtgttctatctg
atcggcaaaatccacaagacgctcggcaacatggatctggcgctgatgcacttcagctgg
gccaccgacctagatcccaaaggtgccaacaatcaaatcaaagatgccttcgactcaatg
gctcatcccagctgctgtccggccaacactacggccctggacgttgatctggagcccact
tcggagcgttccgatgactcgacgcaggcgcagcaggacggaagctacgacagcgactac
tag

DBGET integrated database retrieval system