KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8615Help
Entry
Dmel_CG8615       CDS       T00030                                 

Gene name
RpL18
Definition
(RefSeq) ribosomal protein L18, isoform B
  KO
K02883  large subunit ribosomal protein L18e
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
Module
dme_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG8615 (RpL18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG8615 (RpL18)
Ribosome [BR:dme03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    Dmel_CG8615 (RpL18)
  Archaea
    Dmel_CG8615 (RpL18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 38794
NCBI-ProteinID: NP_001261501
FlyBase: FBgn0035753
UniProt: Q9VS34 M9PHM6
Position
3L
AA seq 188 aa AA seqDB search
MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPP
LSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEV
LTFDQLALRSPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGR
RSSCGYKK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggtattgatatcaaccacaagtacgatcgcaaggttcgcagaaccgagcccaaatcc
caggatgtgtacctgcgcctgctggtcaagctgtaccgcttccttcagcgccgcaccaac
aagaagttcaaccgcatcatcctgaagcgtttgttcatgagcaagatcaacaggccgccg
ctatcgcttcagcgcatcgctcgcttcttcaaggccgccaaccagccggagtctaccatc
gtggtcgtcggcaccgtcaccgacgatgcccgcctcctggtggtgcccaagctcaccgtg
tgcgccctgcacgtcacgcagaccgccagggagcgcatcctgaaggccggcggtgaggtc
ctgaccttcgatcaactggctctccgatcgcccaccggcaagaacacgctgctgctgcag
ggcaggcgtaccgcccgcaccgcctgcaagcacttcggcaaggctcccggtgtgccccac
tcgcacacccgcccctatgtccgctctaagggacgcaagttcgagcgtgctcgtggtcgt
cgctccagctgcggctacaagaagtaa

DBGET integrated database retrieval system