KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8681
Entry
Dmel_CG8681       CDS       T00030                                 

Gene name
clumsy
Definition
(RefSeq) clumsy, isoform B
  KO
K05313  glutamate receptor, ionotropic, invertebrate
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG8681 (clumsy)
Ion channels [BR:dme04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   Dmel_CG8681 (clumsy)
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 Phage_attach
Other DBs
NCBI-GeneID: 35394
NCBI-ProteinID: NP_001036373
FlyBase: FBgn0026255
UniProt: Q0E8N6
Position
2L
AA seq 1002 aa
MYSLFLTHFLLIALPVLADIDRSQFMVGSIFTSDKDESEIAFRTAVDRANILERNVELVP
IVVYANTDDSFIMEKMVCNLISQGVIAIFGPSTGSSSDIIASICDTLDIPHIVYDWIPNE
SIPDREHSTMTLNVHPDNLLLSQGLAEIVQSFAWRSFTVVYETDKELQQLQDILQVGEPI
SNPTTVKQLGPGDDHRPFLKEIKLSTDNCLILHCAPDNLLKILQQANELKMLGEYQSVFI
PLLDTHSIDFGELSGVEANITTVRLMDPSDFHVKNVVHDWEEREKREGRYFKVDPNRVKS
QMILLNDAVWLFSKGLTELGIFEELTAPDLECRRKKPWPFGKRIIEFIKARSEETSTGRI
DFNENGQRSFFTLRFMELNSDGFLDLATWDPVNGLDVLNDDEESEKRVGQKLSNKTFIVS
SRLGAPFLTLREPQEGEILTGNSRYEGYSIDLINEIAKMLNFKFEFRMSPDGKYGALNKV
TQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTLGISILFSKPPTPPTDLFS
FLSPFSLDVWIYMGSAYLFISLLLFALARMAPDDWENPHPCKEPEEVENIWSIMNTTWLS
IGSLMGQGCDILPKAASTRLVTGMWWFFALMMLNSYTANLAAFLTNSRQANSINSAEDLA
AQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMESASPSVFTKTNDEGVERVQKGKNLY
AFLMESTTLEYNVERKCDLVQIGGWLDYKSYGIAMPFNSPYRKQISAAVLKLGELGQLAE
LKRKWWKEMHGGGNCEKSDEDGGDTPELGLENVGGVFLVLGLGLLSAMVLGCTEFLWNVK
SVAIEEKISLKEAFKSEALFAARIWITTKPVHTSSESGSSNSSSSSSSRSKHSFKSQGLS
MKSLKSSGYQDVEASVHSKLKKIGSMFSLKSQKTVTPPPEIGWKLDKSTQIDVVPTSDVD
QELIPEVEPHLPHRHHHHHHHRHHHHHHQPDQEHDRNPSPPE
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgtattctctattcctcactcactttcttctgatcgcgttgccagtcctcgcagacata
gacagaagtcagtttatggtgggtagcatcttcacatcagacaaagatgagtcggaaatc
gcattccgaacagcggtagaccgtgcaaacatattggagcggaacgtagagttggttcca
attgtggtgtatgctaacaccgatgatagtttcatcatggaaaaaatggtttgcaatttg
atttcccaaggagtaatcgccatttttggacccagcacaggcagcagttcagacataatt
gcctcaatatgcgacacactcgatattccgcacatagtatatgactggatacccaatgaa
tctatcccagatcgggaacactctacaatgactcttaatgttcatcccgataacctcttg
ttgtcccaggggctggcggagattgtgcagagctttgcctggcgtagctttacagttgtc
tatgagactgacaaggagcttcaacaacttcaggatattttgcaagtcggtgagcccatc
agcaatccaaccacagtaaaacaactggggccgggtgacgaccaccggccttttttaaag
gaaatcaaactctctaccgataactgcctcatcctacattgtgcccccgacaatttatta
aaaatattgcaacaggcaaatgagctaaaaatgttgggcgagtatcagagcgttttcata
ccactcctggacacccattccatcgattttggtgaactttccggggtcgaggccaacata
actacggttcgactaatggatccatccgattttcacgtgaaaaatgtagtgcacgactgg
gaagaacgcgaaaaacgggagggacgctactttaaagtcgacccaaatagagtcaaatcc
caaatgattctgctcaatgacgccgtttggctcttttctaagggacttaccgaactcgga
attttcgaggagctcaccgctcccgatctagaatgtaggcgaaaaaaaccgtggccattt
ggtaaacgcattattgagttcataaaggcgcggtccgaggagacttcgacgggacgaatt
gactttaatgagaatggacaaagaagttttttcaccctgcgttttatggaattaaactct
gatggctttttggatttagccacttgggatccagtgaacggattggatgtgcttaatgac
gacgaagagagcgagaagagagttggccagaagctgtcgaacaaaacatttattgtatcc
tcacgcctgggagccccattccttacactccgagagccccaggaaggtgaaatcctgacg
gggaattcccgttacgagggatactctatagacttaatcaacgaaattgccaaaatgctg
aactttaagttcgaattccgaatgtcccccgacggaaagtacggtgctctaaataaggtg
acccagacctgggatggcatagtgaggcaactgattgatgggaatgctgaccttggaatc
tgcgatttgacaatgacgtcatcccgacgtcaggcagttgactttacacctccattcatg
accctaggaatcagcatactgttttcgaagcctcccacaccacccactgacttgttttcg
tttttatctccattctccttggatgtgtggatctacatgggctccgcatatctctttatt
tcccttcttttgttcgcattggctcggatggcgcccgacgactgggaaaaccctcatccc
tgcaaggaacccgaagaagtggagaacatatggtcgattatgaacactacatggctctcg
ataggctcattgatggggcaaggctgtgacattctgccgaaagctgcctcaactcggttg
gtcactggaatgtggtggttcttcgctctaatgatgctgaattcctacacggctaatctg
gctgcctttctaaccaattctcggcaggcgaactccatcaacagtgccgaggatctggct
gcacaaagtaaaattaaatacggtgctatggctggtggttccacaatggggttctttcgg
gactcgaactttagcacttaccagaagatgtggaccgccatggaaagcgccagtccttca
gttttcacaaaaaccaacgacgagggcgtcgagagggtacaaaaaggcaagaatttatac
gcctttttaatggagtccaccacattggagtacaatgtggaacgaaagtgcgacctggtg
cagatcggtggctggctagactacaagagctatggcatagcaatgcccttcaattctccg
tatcgcaaacagatcagtgcggcagtgctgaagttgggcgaacttggacagctggcggaa
ctaaagcgaaagtggtggaaggagatgcacggcggcgggaactgcgaaaagagcgacgaa
gatgggggagacacgccagagcttggattggaaaacgtgggtggagtcttcctggtgctt
ggtctcggcttgctttcagcaatggttttgggatgcacggaatttctatggaacgtgaaa
tcggtagcaattgaagaaaagatctcgcttaaggaggcttttaaatcagaggctttgttt
gcggctagaatatggataaccactaaacctgtacatacaagttctgagtctggaagctca
aattcgtctagttcctcgtcaagccgctccaagcattctttcaagtcgcagggattgtca
atgaaaagccttaaaagctcaggatatcaggacgtagaagcttcagtccacagcaaacta
aaaaaaatcggttccatgttctcactaaagtcacagaagacagtcactccacctccagag
ataggctggaaactggacaagtcaacacaaatcgatgtagttccaacatctgatgtagat
caagaattgataccggaggtagaaccacatctaccacatcggcaccatcatcaccatcat
catcgccatcatcatcaccatcatcaacccgatcaggaacatgataggaatccctcgcct
cctgagtaa

DBGET integrated database retrieval system