KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8729
Entry
Dmel_CG8729       CDS       T00030                                 
Symbol
rnh1
Name
(RefSeq) ribonuclease H1, isoform A
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03030  DNA replication
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Dmel_CG8729 (rnh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG8729 (rnh1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Dmel_CG8729 (rnh1)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    Dmel_CG8729 (rnh1)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     Dmel_CG8729 (rnh1)
   Elongation factors (archaeal)
     Dmel_CG8729 (rnh1)
SSDB
Motif
Pfam: RNase_H Cauli_VI RVT_3
Other DBs
NCBI-GeneID: 35746
NCBI-ProteinID: NP_477315
FlyBase: FBgn0023171
UniProt: Q7JY33
Position
2R
AA seq 333 aa
MLLPRYFCWNLQRCTMAFYAVASGRRSGVYGSWAECEEQVKGFKNAKYKKFKTRQEADQF
VNGCKSYAPQDVAVPLGKEKASLASWKNSIEVNKNPKYTDEWPEEDHDLAEDDLNAAMNE
VEGDPKPSNSSNLPDILNRKRKGTTSGDKRNKIPRHASQVSEATGLKQVGAFQFEIDAEG
YVIVYTDGSCIGNGRAGACAGYGVYFGKNHQLNAAKPVEGRVTNNVGEIQAAIHAIKTAL
DLGIQKLCISTDSQFLINSITLWVAGWKKRDWKLKNNQPVKNVVDFKELDKLLQENNITV
KWNYVEAHKGIEGNEMADKLARQGSALYKQKNG
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgttacttccgcggtatttttgctggaacctccaacgctgcacgatggcgttttacgct
gtagccagtgggcggcggtctggagtctacggctcttgggcagagtgcgaggagcaggtc
aagggtttcaagaacgccaaatacaagaagtttaagacacgccaggaagcggatcagttc
gttaatggctgcaagtcgtatgctccgcaggatgtggccgtgccgctgggcaaggaaaag
gcgtcactggccagttggaaaaacagtatcgaagtgaataagaaccccaagtacacagat
gagtggcccgaagaggatcacgacctagccgaggatgatctgaatgctgccatgaacgag
gttgagggagatccaaagccatctaacagtagcaatttaccagacattctcaatcgcaag
cggaagggcacaaccagcggcgataagcggaacaagatcccacgtcatgcctctcaggtc
tcagaagccacaggactcaagcaagtgggtgccttccagtttgaaatcgatgcagagggc
tatgtcattgtgtacacagatggctcctgcataggcaacggacgagccggagcctgtgcc
ggctatggcgtttatttcggcaagaatcaccagctaaacgcagccaagcccgtggaagga
cgcgttacaaataatgtaggtgaaatacaagcggccattcatgccattaaaacagctctt
gacttgggaatacagaagctgtgcatcagcacagactctcagtttttgatcaactccata
acgctgtgggttgcgggttggaaaaaaagggattggaagctaaagaacaatcagcctgtt
aaaaacgttgttgacttcaaggaactggataaactgcttcaggagaacaacatcaccgtg
aaatggaactatgtggaggcccacaagggcatagagggcaatgaaatggcagacaaattg
gcgcggcaaggatccgccttgtataagcagaaaaatggttga

DBGET integrated database retrieval system