KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8782
Entry
Dmel_CG8782       CDS       T00030                                 
Symbol
Oat
Name
(RefSeq) ornithine aminotransferase precursor
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00330  Arginine and proline metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Dmel_CG8782 (Oat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dme01007]
    Dmel_CG8782 (Oat)
Enzymes [BR:dme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     Dmel_CG8782 (Oat)
Amino acid related enzymes [BR:dme01007]
 Aminotransferase (transaminase)
  Class III
   Dmel_CG8782 (Oat)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 40145
NCBI-ProteinID: NP_649139
FlyBase: FBgn0022774
UniProt: Q9VW26
Position
3L
AA seq 431 aa
MFAKLSARGIATRMSFLAQKTASQETTAAAGSRSELVYARENKYGAHNYHPLPVALTKGE
GVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVAALTAQASKLALTSRAFYSDVLGEYEEY
VTKLFGFDKVLPMNTGVEGGETACKLARKWGYLEKKIPANQAKIIFARNNFWGRTLSAVS
ASNDPSSYEGFGPFMPGFELIEYDNVSALEESLKDPNVCAFMVEPIQGEAGVVVPSDGYL
KKVRELCTKYNVLWIADEVQTGLARTGKLLAVDYEQVQPDILILGKALSGGMYPVSAVLC
NDQVMLCIKPGEHGSTYGGNPLGCRVAMAALEVLQEEKLAENAFKMGDLLRNELSTLPKD
VVSVVRGKGLLNAIVINQKFDAWEVCLRLKENGLLAKPTHGDIIRFAPPLVINETQMRES
IDIIRKTILSM
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgttcgccaagctatcagcccgcgggatcgccacccgcatgagcttcttggcacagaag
acagcttcccaggagacgacggccgccgccggatcccgttccgaactcgtctatgccagg
gagaacaagtacggcgcccacaactaccacccactgcccgtggccctgaccaagggcgag
ggcgtgtttgtctgggatgtggagggcaagcgctacttcgactatctgagcgcctactcg
gcggtcaaccagggtcactgccatcccaagatcgtagcggcactcacagcacaggcctcc
aagttggccttgacatcgcgtgccttctattcggatgtccttggagagtacgaggagtac
gtgaccaagctctttggcttcgacaaggtgctgcccatgaacacgggcgttgagggcgga
gaaaccgcctgcaagttggcccgcaagtggggctacctggagaagaagatacctgccaac
caggcaaagatcatcttcgcgcgcaacaacttctggggacgcaccctgtcggcggtgtcc
gcctccaatgatcccagtagctacgagggattcggacccttcatgcccggattcgagctg
atcgagtacgacaatgtgtcagcgctggaggagtccctcaaggatccgaatgtgtgcgcc
ttcatggtggagcccattcagggagaggctggcgtggtggtgcccagtgatggctatctg
aagaaggtgcgagagctctgcaccaagtacaatgtgctctggattgccgacgaggtgcag
acaggattggccagaactggaaagctgctggccgtggactacgagcaggtgcagccagac
attctgatcctgggaaaagcactgtccggaggaatgtatcccgtgtcggcggttctctgc
aacgaccaggtgatgctgtgcatcaagccgggcgagcacggatccacctacggaggcaac
cccctgggctgccgagtggccatggccgccttggaggttctgcaggaggagaagctggcg
gagaacgccttcaaaatgggtgacctgctgcgcaacgagctgtccacgctgcccaaggat
gtggtgtcggtggtgcgcggaaagggtctgctcaacgccatcgttattaaccagaagttc
gatgcctgggaggtgtgcctcaggctaaaggagaacggactcctggccaagcccacccat
ggcgacattattcgcttcgctcctccactggtcatcaatgagacccaaatgcgcgagagc
atcgacataatcaggaaaaccattctgtccatgtag

DBGET integrated database retrieval system