KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8804Help
Entry
Dmel_CG8804       CDS       T00030                                 

Gene name
wun
Definition
(RefSeq) wunen, isoform B
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00561  Glycerolipid metabolism
dme00564  Glycerophospholipid metabolism
dme00565  Ether lipid metabolism
dme00600  Sphingolipid metabolism
dme01100  Metabolic pathways
Module
dme_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Dmel_CG8804 (wun)
   00564 Glycerophospholipid metabolism
    Dmel_CG8804 (wun)
   00565 Ether lipid metabolism
    Dmel_CG8804 (wun)
   00600 Sphingolipid metabolism
    Dmel_CG8804 (wun)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     Dmel_CG8804 (wun)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 PAP2_3 DUF3464 VIT1 PAP2_C Virul_fac_BrkB
Motif
Other DBs
NCBI-GeneID: 35966
NCBI-ProteinID: NP_724787
FlyBase: FBgn0016078
UniProt: Q9V576
Position
2R
AA seq 379 aa AA seqDB search
MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL
QEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFC
DDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNY
ELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAIN
AGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH
LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLFQKPNTKPYLA
RTVQDMNASPAQAITITTN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgtgaaaataataatgagtaccgaaacgtcggcgagcgagacaacaccgctg
cggcggtcggaaaacgaaacacctgaccataaagaactggcccaaagtaacagcaacagt
cgacaaacaacagttaatagcaacaacaataactacagtaactcggtgcaagtgcgtctg
caggaacaggacagagatagcgacagcgagcaacaacaacatactgccaccatcaccatg
gataccaacaaaagaatcctctgccgcgtgggcttggatgttttaatcttgctctgcgct
ggatttcccatactgctgtttttcctgctgggcgagccgtacaagcggggcttcttctgc
gatgacgagtcactgaagcacccgttccacgattctacggtccggaattggatgctatac
ttcatcggagctgtgataccagtcggcgtgatattcatcgtggaggtcatcatttcacag
aacaaggccaagcaggataatggcaatgcaaccagtcgaaggtacgtctttatgaactac
gaactgcccgactggatgatcgagtgctacaagaagatcggcatctatgccttcggcgct
gtgctcagccagctgaccacggatatagccaagtactccatcggccgactgcgtccccat
ttcatcgcggtgtgccagcctcaaatggccgacggcagcacctgcgacgatgcgatcaat
gcgggaaaatacatccaggagttcacatgcaagggagttggatcgtcggcgcgcatgctc
aaagagatgcgcctctccttccccagtggccactccagcttcaccttcttcgccatggtc
tatctggcgctctacctgcaggctcgcatgacctggcggggctccaagctgctgcgtcac
cttctccagttcctgttcatcatggtggcctggtacacagccctaagtcgcgtatcggac
tacaagcaccactggtccgatgtgctggcaggatcgcttattggctccataagcgcactg
gtcgtggccaactatgtctccgacttgtttcaaaagcccaacacgaagccctatttggcg
cgtacagtgcaagacatgaatgcatcgccggcccaggccataacgattactacaaactaa

DBGET integrated database retrieval system