KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8819Help
Entry
Dmel_CG8819       CDS       T00030                                 

Gene name
achi
Definition
(RefSeq) achintya, isoform D
  KO
K19383  homeobox protein TGIF1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dmel_CG8819 (achi)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG8819 (achi)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, TGIF
    Dmel_CG8819 (achi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeodomain
Motif
Other DBs
NCBI-GeneID: 36373
NCBI-ProteinID: NP_001286352
FlyBase: FBgn0033749
UniProt: A1Z916
Position
2R
AA seq 555 aa AA seqDB search
MISPEQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLDQDSLHADVIV
EEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAY
PSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNCS
RSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMV
KMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATMIDKIKNYQMRKAAAIGGSAVGSGG
AGGSSSNSSPATSILPYSLFGQLPPEFDDEEKPRPPKRVRTRTVAAKSPRENAKQAKQKT
GNKQETMYCYKDSYGGIVVSPRSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFG
TEEVSTSAGNNPGTSGSKGSVQNTAIWNRNQTAKRDVNQQLTDFESELNRIQASEIQTID
PTNSNQQDIGDNLQADEVFTGAEAEAGQSQLSAMSQGTSPDERAKYKCLYYLVETAMAVR
QNDDVQDDDFVYMGD
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgccggaacaagaagaggtcaacatggtcctggatcgccatgtacggcagaat
atccaggacatgatgcacgaggctcatgtccaggcgagcctgctggagaacgaaggacgc
ggccgtttccactcggactcaagtttggaccaggattctcttcacgctgacgtcatcgtg
gaggaggatcagagcaccgaacacggcgccaaccaggtgcaaaactaccacgacatgatg
gtggacagtgaacaccacatcgacataaatgggtcgctgcgcaaacgtcgtggaaatctt
cccaagacctctgtaaagattttaaagcgttggctttatgagcaccgctataacgcctat
ccgagcgatgcggagaagttcaccctgtcccaggaggccaatctgacggtgctccaagtg
tgcaactggttcatcaatgcccgtcgccgcattctaccggagatgatcaggcgcgagggc
aacgatcctctgcacttcaccatatcgcgacgtggcaaaaaggttagccccaactgttcg
agatcaagtgcgttgggcgcaaacttgactgggccgaatcccgcacacggaagtcctgct
tccgaagtggtcgttggcgctacagaggaggtggatggcgccggtgagattcacgagggc
atcgccaatgtgctgaccaactttgaacagtatgtgcagggccccaacggacaaatggtc
aagatggagccggagtacgaggacagtgtcatctacagctggcagcaggccattgcaaac
aacccgatgggctttcaaagtcttcactcctcgcttcaagcaaccatgatcgataaaatt
aaaaactatcagatgcgcaaggctgccgccattgggggttcggcggttggctctggtggt
gctggtgggtcgagctccaactccagtcctgccacatcaatactgccatacagccttttt
ggccagctgccgccagagttcgatgacgaagaaaagccaagacctccgaagcgcgtaaga
acgcggacggttgctgcaaagagtcctagggagaatgccaagcaagcaaagcagaagact
gggaataagcaagaaaccatgtactgctataaggattcatacggcggaatcgtggtgtct
cctaggtccgaaggcgaagagagtgcacagggatacgagtcctgtgggccgaacagcgag
gaggaagtacgcttcgagacctcccatgattggcagagcgttataaaaactgtatttggt
actgaggaagtcagcacttcggctggcaataatccaggtacctctggttctaagggatct
gttcagaataccgccatctggaatcgcaatcagactgcgaagcgtgacgtgaatcaacag
ttgactgactttgaaagcgagctgaatagaatacaggcctcagaaatccagacaatcgat
cctaccaactccaatcaacaggacattggtgacaatctacaggcggacgaggtgtttacc
ggtgccgaagcagaagctggccagagtcaattatctgctatgtcgcagggcacaagtcca
gatgagcgtgccaagtacaagtgtctctattatctagtggaaactgccatggctgtgcgc
caaaacgatgacgtccaggatgacgatttcgtttacatgggagactag

DBGET integrated database retrieval system