KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8827Help
Entry
Dmel_CG8827       CDS       T00030                                 

Gene name
Ance
Definition
(RefSeq) angiotensin converting enzyme, isoform C
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG8827 (Ance)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG8827 (Ance)
   04090 CD molecules [BR:dme04090]
    Dmel_CG8827 (Ance)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dmel_CG8827 (Ance)
Peptidases and inhibitors [BR:dme01002]
 Metallo peptidases
  Family M2
   Dmel_CG8827 (Ance)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG8827 (Ance)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG8827 (Ance)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 CENP-O Glyco_transf_8
Motif
Other DBs
NCBI-GeneID: 34805
NCBI-ProteinID: NP_001285915
FlyBase: FBgn0012037
UniProt: Q10714 X2J8C3
Structure
PDB: 

Position
2L
AA seq 615 aa AA seqDB search
MRLFLLALLATLAVTQALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEK
KKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTL
SAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQ
FERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLR
KHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMF
QMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQD
QLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDY
VRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIE
PPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNC
DIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKN
NVHIGWTTSNKCVSS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtttctgctagccctgctggctactttggcggtaacccaagcgctggtcaag
gaggagatacaggccaaggagtatctggagaatctgaacaaggagctggccaagcgaacc
aacgtggaaaccgaagctgcctgggcctatggctccaacatcaccgacgagaacgaaaag
aaaaagaatgagatatccgccgagttggccaagttcatgaaggaggtggccagtgatacc
accaagttccaatggcgctcgtaccaatcggaggatctcaagcgccagttcaaggctcta
accaaactgggctatgctgctctacctgaagacgactatgccgaactgctggacacactc
tccgccatggagtcgaatttcgccaaggtcaaggtgtgcgactacaaggatagcaccaag
tgcgacctagccctcgacccggagatcgaggaggtcatcagcaagagccgtgaccacgag
gagctcgcctactactggcgcgagttctacgacaaggccggaaccgccgtgcgatctcaa
ttcgaacgctacgtggagctcaacaccaaggcagccaaactgaataactttacttctggt
gccgaggcctggttggatgagtacgaggacgacaccttcgagcagcagctggaggacatc
ttcgcggatattcgtccgctttaccagcagatccatggctatgtgcgtttccgcctgagg
aaacactatggtgacgcggtggtctccgagacaggacccattcccatgcacctattgggc
aacatgtgggcacagcagtggtcagagattgcggacatcgtatccccctttccggagaag
cctctggtggatgtgagcgctgagatggaaaagcagggctacacgccactcaaaatgttc
caaatgggcgacgacttcttcacgtctatgaatcttaccaagctgccacaggacttctgg
gacaagtcgatcattgagaagcccaccgatggtcgtgatctggtttgccatgccagcgcc
tgggacttttatctcaccgacgatgtgcgcatcaagcagtgcacccgggttacacaggat
cagctcttcaccgttcatcacgaactgggacacattcagtatttcctgcagtatcaacac
caacccttcgtctatcgcactggtgccaatcccggtttccacgaagctgtcggtgatgtg
ctctccctgtccgtatcgacacccaaacatctcgagaagattggcctgttgaaggattat
gtgcgcgatgacgaggctcgcatcaaccagctcttcctcaccgccctggataagatcgtt
ttcctgcccttcgccttcaccatggacaagtatcgctggtcgctgttccgcggtgaagtc
gacaaggccaactggaactgtgccttctggaagttgagggacgagtactccggcattgag
ccgccagttgtgcgaagcgaaaaggactttgatgccccggccaagtatcacatttccgcc
gatgtcgagtatctgagatacttggtctccttcatcattcagttccagttctacaagtcc
gcctgcatcaaggctggccaatatgatcccgacaatgtggagttgcctctggataattgc
gatatctacggaagtgctgcagctggtgctgctttccacaacatgctgtccatgggcgcc
tcgaagccatggcccgatgcactggaggccttcaacggcgagcgcatcatgtccggaaag
gccatcgccgaatactttgagccactgcgcgtttggctggaggcggagaacattaagaac
aatgtccacattggctggactacttcaaataaatgcgtctcatcataa

DBGET integrated database retrieval system