KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8862Help
Entry
Dmel_CG8862       CDS       T00030                                 

Gene name
EndoG
Definition
(RefSeq) endonuclease G
  KO
K01173  endonuclease G, mitochondrial
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG8862 (EndoG)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    Dmel_CG8862 (EndoG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endonuclease_NS
Motif
Other DBs
NCBI-GeneID: 36309
NCBI-ProteinID: NP_610737
FlyBase: FBgn0033690
UniProt: Q7JXB9
Structure
PDB: 

Position
2R
AA seq 310 aa AA seqDB search
MSAPRVGGVLALGATALGAFYLGTHVERERQHNGSTSGLPRLPGLPTFGTVSAASLIPAQ
ENNVSLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKND
AVDRSKCDFKQDESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAP
QVGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAV
PTHFYKVIVGESADHKLHMESYVMPNQVISNDTPISVFQVPPESVERSAGLLFFDQINRK
QLTTINGKKV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcctcgagtgggtggcgtattagctttgggtgccaccgccctgggcgccttt
tatctgggcacccacgtggaacgcgaacgccagcacaatggctccacaagtggccttccg
cggctgcctggtctgcccacctttggaactgtttcggctgccagtttgattcccgcccaa
gagaacaatgtaagcttgacggcaactccgtctcggatcggacagatcatgaagtatgga
tttcccggactcgatcacgtgcgctcccattcggactacgtgctgtcttacgatcggagg
aaccgggtgccccactgggtgttcgagcaccttacggcagagtcggtggcgaagaacgat
gccgtggacagatcgaagtgcgatttcaagcaggacgagagcatccatccgttcttcagg
tcacagaacacggactaccgacgatcgggctatgatcgcgggcacatggccgccgctgga
aatcaccgactgcaccagaagcactgcgacgaaaccttctacctatcgaacatggcgcca
caggtgggccagggcttcaaccgggatgcctggaacacgctggaggcacacgtgcgcaga
ctgaccaagacctactccaatgtgtacgtctgtacgggtccactgtacctaccgcacaag
gaggacgatgggaaatcgtatgtcaagtacgaggtcatcggcgccaacaccgtggctgtt
cccacccacttctacaaggttattgtgggcgagtccgcggaccacaaactccacatggag
tcgtacgtgatgcccaatcaggtgatcagcaacgacactcccatcagtgtgtttcaggtg
ccgccagagagcgtggaacgctcggcgggattgctcttcttcgatcaaatcaatcgcaag
cagctaaccaccatcaatggcaagaaagtctag

DBGET integrated database retrieval system