KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9062Help
Entry
Dmel_CG9062       CDS       T00030                                 

Gene name
CG9062
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K15361  WD repeat-containing protein 48
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    Dmel_CG9062 (CG9062)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG9062 (CG9062)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     Dmel_CG9062 (CG9062)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3337 WD40 ANAPC4_WD40 Ge1_WD40 Nup160 WD40_like
Motif
Other DBs
NCBI-GeneID: 36199
NCBI-ProteinID: NP_725018
FlyBase: FBgn0033607
UniProt: Q1LZ08
Position
2R
AA seq 668 aa AA seqDB search
MLTHKTCQARKKMQVSFVIRDAEEKQHRNGVNALQLDANNGKLYSAGRDAIIRVWNTRTD
SSEKYIQSMEHHNDWVNDIVLCCNGRNLISASCDTTVKVWNAQKGFCMSTLRTHRDYVQA
LAYAKDREQVASAGLDKAIFLWDVNTLTALTASNNTVTTSSLTGSKDSIYSLAMNPSGTV
IVSGSTENILRIWDPRTCMRRMKLRGHTENVRCLVVSPDGNQVVSGSSDGTIKVWNLGQQ
RCVQTIHVHKEGVWSLLMSENFQYIISGSRDRNIIVTEMRNPSNKTLVCEEQAPVLSLGY
NIDKTGVWATTWNSDIRCWKLPMYDRCTLNSSGGMDAQWTQGGTEVACIKGGAAIKECAV
LNDKRYIITKDSQDQVVVYDVLRVVKKEQLGAVDFEAEVKKRNKQVYIPNWFTVDLKTGM
PTIVLGQEEVDCFSAWVSIEAGLPECVDPTTEIKINYGKLLLEALLEYWTPPHSIPPNEM
EPDMHGNGYFQVPKHTPVIFSEVGGRTVCRLLVRDAAGDSESTLLHETAPQWVTDVVIEK
NIPKFLKIPFFLQPHPQMTKPERTKKDRLVANEFIQCRKVCEHVLEKVLNAETTPSGGNA
NNSLQNSQSDANSEGSQLPAEERIELWCNDVVVDPNMDLRTVRHFIWKQSTDLTFQYKTK
QNFNYDGK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgcacaaaacttgtcaggcacgtaagaaaatgcaggtttccttcgtgatacgg
gacgccgaggagaaacagcaccggaatggcgtaaacgctctgcagctggatgccaataac
ggcaagttgtactccgccggtcgcgacgccataatccgtgtgtggaatacacggacggac
tccagcgagaagtacatacaatcgatggagcaccacaacgactgggtcaacgacatagta
ctttgctgtaatggcaggaaccttattagcgccagctgtgataccacggtgaaggtgtgg
aacgcccagaaaggcttctgcatgtccaccctgcggacccatcgcgactacgtgcaggcg
ttggcctacgccaaggatcgggaacaggtggccagcgctggactggacaaggccatcttc
ctgtgggacgtgaacacactgaccgcgctcacggcgagcaataacacggttaccacctct
agtctaaccgggtccaaggactcaatctacagcttggccatgaatccatcgggcaccgtg
attgtgagcgggtccacggagaatatactgcgtatctgggatccccgcacctgtatgcgc
agaatgaagctgcgaggccatacggagaacgtgcgctgcttggtggtgtcgcccgatgga
aaccaggtggtgtctggcagttccgacggcacgatcaaggtgtggaacctgggccaacag
cgctgtgttcaaaccatccacgtgcacaaggagggcgtgtggtcgctgctgatgagcgag
aacttccagtacatcatctccggcagtcgggatcgcaacatcattgtgaccgagatgcgg
aaccctagtaacaaaacgcttgtgtgcgaggagcaggcgcccgtgctgagtctgggctac
aacatcgacaagactggggtgtgggccaccacctggaactcggacattcgctgttggaag
ctgcccatgtacgacaggtgcacactaaattcctcgggcggaatggacgcacaatggaca
cagggcggcactgaggtggcctgcataaaaggtggagccgccatcaaggagtgcgcggtg
ctgaacgacaaacgttatatcataaccaaggactcacaagatcaggtcgtggtgtacgat
gtgctgagagttgtcaaaaaagagcaattgggcgctgttgatttcgaagcggaggtgaag
aagcgtaataagcaggtctacattccaaactggttcactgttgatctgaaaaccgggatg
ccaacgattgtattgggtcaggaggaagtggattgcttttccgcttgggtttccattgaa
gctggactgccggagtgcgtcgatcccacaacagagattaagatcaactatggcaaatta
cttttagaagccctgctagagtactggacaccaccgcatagcataccaccaaacgaaatg
gaacccgatatgcacggcaatggctacttccaagtgcccaagcacacgcccgtcatcttt
agtgaagtgggtggccgcactgtttgccgacttttggtacgcgacgcagctggcgatagc
gaaagtaccctgctccacgaaacggcgcctcagtgggtgaccgacgtggtgatcgagaag
aacattcccaagttcctcaaaataccgttcttcctgcagcctcacccgcaaatgaccaag
cctgaacgaacgaagaaggatcgtcttgtggctaatgaatttattcagtgtcgcaaggtc
tgcgagcacgtgcttgaaaaggtgctgaatgcggaaactaccccaagtgggggcaatgct
aacaattcactgcagaatagccagagcgatgctaattcggagggatcccaactgccagct
gaggaacgaattgaactgtggtgtaacgatgtggttgtggaccccaacatggacctgcgc
acggtgcgccactttatctggaagcagtcgaccgatctaacgtttcagtacaagaccaaa
cagaatttcaactacgatggtaaataa

DBGET integrated database retrieval system