KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9144
Entry
Dmel_CG9144       CDS       T00030                                 

Gene name
Fbw5
Definition
(RefSeq) F-box and WD repeat domain containing 5
  KO
K10263  F-box and WD-40 domain protein 5
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG9144 (Fbw5)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG9144 (Fbw5)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     Dmel_CG9144 (Fbw5)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     Dmel_CG9144 (Fbw5)
SSDB
Motif
Pfam: WD40 F-box-like F-box
Other DBs
NCBI-GeneID: 33854
NCBI-ProteinID: NP_608989
FlyBase: FBgn0031773
UniProt: Q9VMI1
Position
2L
AA seq 656 aa
MEVTFKKARLGKERLVEQSEEEERDEGSSGQDLFGWWALPEPALLMIFERLSVPDLLRAS
RCCVRWHSIAKDDLLWRHKFQEHFKASPSIPLKPGSESWRAEYKRLSMHIPFVQAQRLEP
TVENNHGHTHQVLHVSFAHNGEMFATCSKDGYVIIWNAQHPCSEKYAHNMKQFSWKYSQY
SQFNQSDTLLLVSGVHFGSPQSTSGEIAVFYLGATESHLRCRVVNRPYDIFGTWFSDQYL
ISGDLHWLAHLVSTSVLWLNKANQEIDSEHVPIMSQLYKFYNRNASSVRAIMVARCPWLD
ESNDPLATTADQESHSSVLSPPTGDQGSTSQASGNPVSHAASILRTRSSTPEENYLPDIS
ERRSRARLGDATIHYLDEYRTAVATTNESNDDDDEEYDSMDVQEEYDEMENSIPKYLIFS
TGSTTFTPHQIGFKRIRNVFFPKKLDPGPSLKERIAAKRAAEQQQQQTPRTDPDWWDYES
VKDRFDKVDKVIDLHGHIIGMALSPDHRYLYVNTRPWPKNYVITNPLEPPPIAQEIDIHV
IDLMTLKRVGNMLRAHKAYTPSAECFFIFLDVCEEYVASGAEDQHAYLWDRYYGISLAKF
KHSDVVNSVAFNPRDSEMLVTTSDDYTIKVWRSRAKAKEFNIPINVSESFELKPKN
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggaagtgaccttcaagaaggcccgactgggaaaggagagactggtggaacaatcggag
gaggaggaacgcgatgagggctcctctggccaagatttgtttgggtggtgggccctgccg
gagccagcgctcttgatgatctttgagcgcctgagtgtgcccgatctgctgagggcgagt
cgctgctgtgtgcggtggcacagcatcgccaaggacgacttattgtggcgccacaagttc
caggagcacttcaaagcctctccgagcattccgctcaagccggggtccgaaagctggcga
gcggagtacaagcgcctgtccatgcacataccctttgtccaggcacagcgactggagccc
actgtggagaacaaccacggccacacgcaccaagtgctgcatgtaagctttgcccacaac
ggggaaatgtttgccacctgctccaaggacggatatgtgataatctggaacgcccagcat
ccgtgttcggagaagtatgcgcacaacatgaagcagttcagctggaagtactcccaatac
tcgcagttcaatcaaagcgacaccttgcttctcgtctccggtgttcactttggttcgccc
caatccacttccggggagattgctgtattctatttgggagcaacagagtcacacctacgc
tgccgggtggtaaatcgtccgtatgacatctttggcacctggttcagtgaccaatatctg
atctcaggcgacctgcactggctggcgcacttggtgagcacctcggttctgtggctgaac
aaggccaaccaagaaattgactcggagcatgtgccgatcatgagccagctatataagttt
tacaaccgaaatgctagttcggttcgagctataatggtggccaggtgtccatggctggac
gagagtaacgatcccctggccactactgccgaccaagaaagtcacagctcagtgctctcg
ccacccactggagatcagggatctacctcgcaggccagtggcaatccagtgtcccacgct
gccagcatactacgcacaagaagctcaacacccgaagaaaactacttgccggacatcagt
gagcgccgttctagagcgagactcggcgatgccaccattcactacttagatgaatacagg
acagcagtggccaccactaatgaatcgaacgatgacgacgacgaggagtacgactctatg
gacgtacaagaggaatacgacgaaatggagaacagtatacccaaatatctaattttttca
acgggctccaccaccttcacgcctcaccaaattggattcaagcgcatacgcaacgtgttc
tttcccaaaaagcttgatcctgggccaagtcttaaagaaagaatagctgcaaagcgcgct
gccgaacagcaacagcagcagaccccgcggactgatccagactggtgggattatgagtca
gtcaaggatagattcgacaaggtggacaaggtaattgacttgcacggacatattattggc
atggcactgagcccggaccaccgctacttgtacgtcaacacacgtccctggccaaagaac
tacgtgatcaccaaccctctggagccgccaccaattgctcaagagattgacatccacgta
attgacctaatgactctcaagcgggtgggcaacatgctgcgcgcccacaaggcctacact
cccagcgcggagtgcttctttatcttccttgatgtttgcgaggagtacgtggccagtgga
gcggaagatcaacatgcctacctgtgggataggtactacggcatcagcctagcaaagttt
aagcactcggatgtggttaacagtgtggccttcaatcctcgcgactcggagatgctggtc
accaccagcgacgactacacaattaaggtctggcgatcacgagcaaaggcaaaggagttc
aatatccccattaacgtcagcgaatcctttgagttgaagccgaaaaactaa

DBGET integrated database retrieval system