KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9165
Entry
Dmel_CG9165       CDS       T00030                                 

Gene name
l(3)02640
Definition
(RefSeq) lethal (3) 02640
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00860  Porphyrin and chlorophyll metabolism
dme01100  Metabolic pathways
dme01240  Biosynthesis of cofactors
Module
dme_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG9165 (l(3)02640)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     Dmel_CG9165 (l(3)02640)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC
Other DBs
NCBI-GeneID: 46140
NCBI-ProteinID: NP_612103
FlyBase: FBgn0010786
UniProt: Q9W0G4
Position
3L
AA seq 652 aa
MSAQEKVIRVGSRKSELALIQTKHVIGRLQKLYPKQKFEIHTMSTFGDRVLNVSLPKIGE
KSLFTRDLEDALRNGGVDFVVHSLKDLPTALPTGMAIGAVLEREDARDALVLRENFKGHT
IASLPKGSVIGTSSLRRTAQIRRMYPHLTVCDIRGNLNTRLAKLDAADSKFSGIILAQAG
LVRMGWMSRISQVLEPTDLLYAVGQGALAVECRANDDQVLAMLQKLMCLNTTCRILAERS
FLKTLGGGCSAPVAVWSNLKGEPLNGNSQEVGLSLTGAVWSLDGAIEIRNHLACALNEQK
LEGDQRKRGAQEATSQLQEETSSSCDSPPATKRARNGNDSSGSDSNSSSPRQQGSPPVIC
EDAAACAALSGYTVDQLSDLASHCPVLSNNNAVGPTGVSGGGDADTNNVNTTPRQCPLRL
VGGQEVMGQCPVPHNQAMVPAKCPVAHADSGDSFSAKSGSGGESATTAHCPLQMPVGQDF
MGECPYVNNDVKVSFAQAGKCPVTGGVAGASASILPTPPSSRASNASSAGDEVDNVATSS
KCPFAAMHQGSGLEAPAKDNGNAATAKCPFLQKTVQMFDYADEEQPTPQHSVLIEDVENL
FCGLYQHACHSRGIYEKANQLGKTLAEDLIKRGALDVMKVAQAEIHGKVASS
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgtcggcgcaggaaaaggttatacgcgttggatcgcgaaagagcgagctcgctctgatt
cagaccaaacatgtcatcggccgcctgcagaagctatatcccaagcagaaattcgagatc
cacaccatgtcgacatttggcgatcgtgtgctgaacgtttcccttcctaagattggcgag
aagagcctgttcacccgcgacctcgaggatgcgctgcgcaacggtggcgttgactttgtg
gtgcactccctcaaggatctgcctacagccctgccaacaggaatggccatcggagccgtg
ctggagcgagaagatgcgcgggacgccctcgttctgcgggagaacttcaagggccacacg
atagcctcgcttccaaagggcagcgtgattggaacctcatctcttcgtcgcacagcccag
attcgcaggatgtatccccatttgacggtgtgcgacatccgtggaaatctaaatactcga
ctggccaagctggatgcagccgattccaagttctccggcatcatactcgctcaggccggc
ttggtgagaatgggctggatgagtcgtattagccaggtgctggagccgaccgacttgctc
tatgctgttggccaaggagccctggccgtggagtgtcgggctaatgacgaccaagtgctg
gcaatgctgcagaaacttatgtgcctgaatacaacgtgccgcatcctagcagaacgaagc
ttcctgaagactttgggagggggttgctccgcccccgtggctgtttggagcaacttaaag
ggcgagcccttgaatggaaacagccaggaggtgggactatccctcaccggtgcagtttgg
agcctggatggtgcaatagagatacggaaccatctggcatgtgccttaaatgaacaaaaa
ttggagggggaccaacggaaacgaggggcccaggaggccaccagccagttgcaggaggag
accagcagcagctgcgattctcccccggccacgaagcgtgccagaaatggcaacgacagt
tcgggttcggactcgaattccagcagtccgcgccagcaaggcagccctccagtgatctgt
gaggatgcggctgcttgcgcagctctctccggttacactgtggatcagctctcggatctg
gccagtcactgcccagtgctgagtaacaacaatgctgtgggacctaccggagttagtggt
ggtggcgatgcggataccaacaatgtgaacaccactccccgtcagtgccctcttcgcttg
gtgggcggtcaggaagtgatgggccagtgcccagtgccgcacaatcaggcaatggttcct
gccaaatgtccagtagcgcatgcagactctggggattccttcagcgccaagagtggaagt
ggaggggaatcggccaccactgctcactgtccactacagatgcccgtgggacaggacttc
atgggcgaatgtccgtacgttaacaacgatgtgaaggtatcctttgcccaagctggaaag
tgtccagtgactggcggtgtggcaggagcatcagcttctattttgcccacgccaccgagc
agcagagccagtaatgccagcagcgctggcgatgaagtggataatgttgcaacttcctcc
aagtgtccctttgcggccatgcatcagggcagcggtcttgaggcgccggctaaggacaac
ggaaacgcagccacagccaagtgcccgttcctgcagaaaacggtccaaatgttcgactac
gccgacgaggagcagccgacgccgcagcactcggtgctcattgaggatgtggaaaacctg
ttctgcggtctctaccagcacgcctgtcacagtcggggcatctacgagaaggccaaccag
ctgggcaagacgctggcggaggacctgatcaagcgcggcgccctcgacgtgatgaaggtg
gcccaggcagagattcacggcaaagtggcgtcgtcttga

DBGET integrated database retrieval system