KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9194Help
Entry
Dmel_CG9194       CDS       T00030                                 

Gene name
CG9194
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans
Motif
Other DBs
NCBI-GeneID: 38133
NCBI-ProteinID: NP_612084
FlyBase: FBgn0035192
UniProt: Q9W0J0
Position
3L
AA seq 729 aa AA seqDB search
MSGRRAQSLPAHMLEPAKPQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQ
HLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIK
ADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLI
CLSNIGDVMATSFRFLYWRICCYVCTRTAKRPRNARSRQRSMRSQRHARSQPPPSFRRSM
KMTQRSGNDSGLGPSMGHAYSDPDLRTMGRGYDDREFGHRSSGGGRNRRQQQQQHLHHDP
RQRHTIYGDGYETQTLNRSNRYSSRQRQRDRMRDRHTVERERYSRSHLDAGSIEDFGDMQ
PPAKRAASVRSVRSPHNQESSKASRELHRLHSAPGRSRAKSVDPRHVSSHYEDVDEDVVR
KTPIIPNRYALDDFGGNRRQAAPRSQSMPRSAHQRQRQKDRERERSPQPPPQSSYRQQHD
RRAGSLGRQSSRYGNHLELPDYDAPPPGRDHRRDRRGHSQGRYEDYVEESFDEGSLYGDN
NYEDYPPERHHSRSREPKRNRRRERAERLPPSPRIMSPMGFPVQRQIRRRPSYDYDDDDS
MYGDEYGDYGDLLPKDRPVPIWLCVFLVVSYILGGAVLFAYWENWSFLDSAYFCFITLTT
IGFGDFVPAKGVKDESEQSIAYCSLYLLFGIALLAMSFNLVQEEFIANVKEVARRLGILK
DDDDEQDED
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtaggcgggcccaatctctgccggcgcacatgttggagccagcgaagccgcaa
cgcggacgctgtgtagctgccatctgcttctcgtggaaggtgctcacctgcattgtgtcc
catgtgctgctcgtgcttctcgtggtttcctattgcgtgggcggtgcctacctcttccag
catctcgaacgaccccacgaactagaggtgaagcgagacatacagaatcttcgcgttaat
ctcacggagaatatctggctactgtccgacgacgcagtggtcctaagggaaagcgattgg
atggccaatgtcagcaagcacctggccaattttgaaaagcaaatccttacggccatcaag
gccgacggctgggatggcgacgaggatctgcgcaagtcccagtggacctttgccggatcc
ctgttctactcgattattgtgataacgaccataggctatggtcacatatcgccgcgtacg
gattggggcaaggtgacaacgattttctacgccattgtgggcattccgctgatgctcatc
tgcttgtccaacattggcgatgtcatggccacatcatttcggtttctgtactggagaata
tgctgctatgtgtgcacccgcacggccaaacgtccgaggaatgcccgatcccggcagaga
tcgatgcgctctcagcgccatgcccgatcccagccgccgccctcgttccggcgctccatg
aagatgacccaacggtctgggaatgactcgggtctgggtccttccatgggtcatgcctat
tcagatcccgacctgcgcaccatgggccggggctacgatgaccgcgagttcggacatcgg
agcagtggaggcggacgcaatcgtcgtcagcagcagcagcagcatttgcatcacgatcct
cgccagcgtcacaccatttacggagatgggtacgaaactcagaccctgaacagatccaac
cgctacagtagccggcaaagacaacgggatcggatgagggacagacacacggtagaaagg
gagcgctactctcgatcccacttggatgctggatccattgaggacttcggtgacatgcaa
cctcctgcgaaaagagctgccagtgtgcgatcggttcgatcgccacacaatcaggaatct
tccaaagcgtccagagaactgcatcgtcttcactcggcacctgggagaagtagggccaag
tccgtggatcccaggcacgtttcttcacattacgaagacgtcgacgaggacgtggtgagg
aaaacaccaattataccaaataggtatgctttagatgacttcgggggcaacagaagacaa
gcagctccaaggagtcaatccatgcccagatctgctcaccaaaggcaacgccagaaggac
agagaacgggaacgatctccacagccgccaccgcagagctcctatcgccaacagcatgat
agacgagctggaagtctgggcaggcaatcatctcgctatggcaaccatctcgaacttccc
gactatgatgctccaccgccgggacgggaccatcgacgggataggcgtggtcactcccag
ggtcgctacgaggactacgtggaagagagcttcgatgagggatccctttacggagacaat
aactacgaggattatccgcctgagcgccaccactcaaggagtcgagaaccaaaaagaaat
cgccgaagagagcgggctgaacgtttgcccccttccccgagaatcatgtcaccaatggga
tttccggtccagcggcaaatccgtcggcgacccagctacgattacgacgacgatgactct
atgtacggggatgagtatggggactatggagatctgctgcccaaggatcgacctgtcccc
atttggttatgcgtctttctggtagtgagctacatccttggcggagctgttctttttgcg
tactgggagaactggtccttcttggattccgcctacttttgcttcattacactgacaaca
atcggatttggtgactttgtccccgcgaaaggagtcaaggacgagtcggagcagtccatc
gcctattgctcgctgtaccttcttttcggcattgccttgttggccatgagttttaacctg
gtccaggaggagttcattgccaatgtgaaggaggtagcccgccgtctgggcattcttaag
gatgatgacgacgagcaggatgaggattag

DBGET integrated database retrieval system