KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9258
Entry
Dmel_CG9258       CDS       T00030                                 

Gene name
nrv1
Definition
(RefSeq) nervana 1, isoform B
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dme04090]
    Dmel_CG9258 (nrv1)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG9258 (nrv1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 33952
NCBI-ProteinID: NP_001260163
FlyBase: FBgn0015776
UniProt: Q24046 B5RIR1
Position
2L
AA seq 309 aa
MSKNNGKGAKGEFEFPQPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAA
LFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDY
WIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCI
FLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIR
YFPSQGFPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKG
SVTFQILLD
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtcaaagaataacggaaagggcgccaaaggcgaattcgaattcccgcagccagcgaag
aagcaaaccttctcggaaatgatctacaatccccaggaaggcaccttcttcggacgcacc
ggaaaaagttggagtcagctactgctgttctacacaatcttctacatcgttctggccgcc
ctcttcaccatttgcatgcagggtcttctgtccaccatcagcgatacggaacccaagtgg
aagctgcaagactcgctgataggcaccaatcccggcctgggattccgtccattgagtgag
cagaccgagcgaggatcggtgatcgccttcgatggcaagaaaccggccgagagcgattac
tggatcgagctgattgatgacttcctccgggactacaaccacaccgagggacgggatatg
aagcactgcggcttcggtcaggtcctcgaacccacggatgtgtgtgtggtgaacacggat
ctgtttggcggctgttccaaggccaataactatggctacaagacgaaccagccctgcata
ttcttgaagctgaataagatctttggctggattccggaagtgtacgataaggaggagaag
gatatgcctgatgatctgaaaaaggtgatcaatgagacgaaaacggaggagcggcagcaa
gtctgggtgagctgcaacggtcacttgggcaaggacaaggagaacttccagaacatccgc
tacttccccagccaagggttcccaagctactactacccgttcctgaaccagccgggttac
ctgagtccgctggtggccgtgcagttcaactccccgcccaagggtcaaatgctggacgtg
gagtgccgtgcctgggccaagaatattcagtacagtggcagtgtccgcgatcgcaagggc
tccgtgaccttccagatcctcctggactaa

DBGET integrated database retrieval system