KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9331Help
Entry
Dmel_CG9331       CDS       T00030                                 

Gene name
CG9331
Definition
(RefSeq) uncharacterized protein, isoform F
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 35347
NCBI-ProteinID: NP_001188857
FlyBase: FBgn0032889
UniProt: Q7KT11
Position
2L
AA seq 326 aa AA seqDB search
MSAGKAFKVLVTHPEVPQEGIDLLKENCEIVQVQSVPINRAELLEKIRGVDGVLWGGHEP
LNAEALDAAGPQLKSISTMSAGIDYVDVPEVKRRKIPLGHTPTVLNTAVADLAVGLLIAA
SRRFHEGRKTIDNDKWENYHLNWLLGQDIRDSTVGFYGFGGIGQAIAKRLSGFDIDKVLY
TTRRRVHKEIEEEFNAKKVDFDTLLAESDFVVIASPLTKDTQGVFNATAFNKMKQTAVLV
NIARGKIVNQDDLYEALKANRIFSAGLDVTDPEPLSPKDKLLTLDNVVVLPHIGSATKRT
RADMSTIAAHNVLRGLAGEPMLSPAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctggcaaggctttcaaggtcctggtgacacatcccgaggttccccaggagggc
attgatctgctgaaggagaactgcgagatcgtccaggtgcagagtgttcccatcaaccgg
gcggagctgctggagaaaatccgtggcgtggatggcgttctctggggtggacacgaaccc
ctcaatgccgaggccctcgatgctgccggtccccagctgaaatccatctccaccatgtcg
gcgggaatcgactacgtcgatgtgccggaggtaaagagacgtaagatcccgctgggacac
acgcccaccgttctcaacaccgccgtggccgatttggcagtgggtctcctgatcgccgcc
agtcgccgttttcacgagggtcgcaagaccatcgacaatgacaagtgggaaaactaccat
cttaactggctgttgggccaggatattcgtgattccaccgtgggattctacggctttgga
ggcattggtcaggctattgccaagcgtttgtctggattcgacattgacaaggtgctgtac
accacccgtcgtcgtgttcacaaggagatcgaggaggagttcaatgccaagaaagttgac
ttcgatacccttctggccgagagtgacttcgtagtgatcgcttctcctttgacgaaggac
acacagggcgtctttaatgccaccgccttcaacaagatgaagcagactgctgtgctggtt
aacattgccaggggcaaaatcgtcaaccaggatgacctctacgaggctttgaaagccaac
cgaatcttttccgccggactcgacgtcacggatccggaaccattgtcgcccaaggacaag
ctgctgacgcttgacaatgttgttgtcctgccccatattggatccgccacgaagcgcacc
cgtgccgacatgtccaccattgctgcccataatgtgctccgcggtttggctggggagccc
atgttgtcgcccgcctactag

DBGET integrated database retrieval system