KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9438
Entry
Dmel_CG9438       CDS       T00030                                 

Symbol
Cyp6a2
Name
(RefSeq) cytochrome P450-6a2
  KO
K14999  cytochrome P450 family 6 [EC:1.14.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dme00199]
    Dmel_CG9438 (Cyp6a2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     Dmel_CG9438 (Cyp6a2)
Cytochrome P450 [BR:dme00199]
 Cytochrome P450, animal type
  CYP6 family
   Dmel_CG9438 (Cyp6a2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 35587
NCBI-ProteinID: NP_523628
FlyBase: FBgn0000473
UniProt: P33270 A0A075BR14
Position
2R:complement(6779749..6781491)
AA seq 506 aa
MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYY
NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFN
LDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMA
RFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMR
MMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGEL
AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMT
YLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNP
ETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTT
EIPLKYSPMSIVLGTVGGIYLRVERI
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtttgttctaatatacctgttgatcgcgatctcctcgcttttggcctacttgtaccac
cgcaacttcaactactggaatcgccgcggcgtgccacacgatgctcctcacccactgtat
ggcaacatggtcgggttccggaagaaccgggtgatgcacgacttcttctacgactactac
aacaagtaccggaagagcggctttcccttcgtgggcttttactttctgcacaagccggcc
gccttcatcgtggacacccagctggccaagaacatcctgatcaaggatttctcgaacttt
gccgatcgtggccagtttcacaacgggcgcgacgacccgctcacgcagcacctgttcaac
ctggacggaaagaagtggaaggacatgcgccagaggctgacgccgactttcacctcgggc
aagatgaagttcatgttcccgacggtgatcaaggtgtctgaggagttcgtcaaggtgatc
acggagcaggtgcccgccgcccagaacggcgctgtgctcgagatcaaggagctgatggcc
aggttcaccaccgatgtgattggcacctgtgccttcggcattgagtgtaacacgctgcgc
acccctgtcagtgatttccgcaccatgggacagaaggtgttcaccgatatgcgccacggg
aaactgctgaccatgttcgtgttcagctttcccaagctggccagcaggttgagaatgcgc
atgatgcccgaggacgtccaccagttcttcatgcgcctggtcaacgacacgattgccctc
agggagcgggagaacttcaagaggaacgacttcatgaacctgctgattgaactgaagcag
aaggggcgcgtcaccctggacaacggagaggtgatcgagggcatggacatcggcgaactg
gccgcccaggtgttcgtcttttatgtggccggatttgagacctcctcctcgacaatgagt
tactgcctgtatgagttggctcagaatcaggacattcaggacaggctgcgcaacgagatc
caaacggtgctggaggaacaggaggggcagctaacgtacgaatccatcaaagccatgacc
tacttgaaccaggtcatctcagaaaccctgaggctctacacactggtgccccacctcgaa
cggaaggccctcaacgactacgtggtgccgggccatgaaaagcttgtgattgagaagggc
acacaggtcataatccccgcttgcgcctaccaccgcgacgaggatctttatccgaatccg
gagacctttgatccggagcgcttctcgccggagaaagtggccgcccgggagtccgtggag
tggctgcccttcggcgacgggccgcggaactgcatcgggatgcggtttggacaaatgcag
gctcgcatcggtttggctcagatcatcagccggttcagggtatccgtctgcgatacgaca
gagatcccactgaagtatagtcccatgtccatagttttgggcaccgttgggggcatctac
ttgcgagtggaacgcatctaa

DBGET integrated database retrieval system