KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9441Help
Entry
Dmel_CG9441       CDS       T00030                                 

Gene name
Pu
Definition
(RefSeq) punch, isoform A
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00790  Folate biosynthesis
dme01100  Metabolic pathways
Module
dme_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmel_CG9441 (Pu)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dmel_CG9441 (Pu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 37415
NCBI-ProteinID: NP_726038
FlyBase: FBgn0003162
UniProt: P48596
Position
2R
AA seq 324 aa AA seqDB search
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSLADRQQNQAEE
ATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDSDGTQPKTPLTPRTSTTPGHE
KCTFHHDLELDHKPPTREALLPDMARSYRLLLGGLGENPDRQGLIKTPERAAKAMLYFTK
GYDQSLEDVLNGAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSK
LARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVT
STMLGVFRDDPKTREEFLNLVNSK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagctttacccgccaactgtccgagatgagtgccagcgagctgaacgatgccatcgac
gacaccaacttcccgcaggcccacatcctttcgcgcggacgcaacaacagcgtctgctca
acaagtagcacctcgggcacctcctcgctggcggacaggcagcagaaccaggcggaggag
gccactgccattgcgggcacacccgtcgaggaggtggcgccagctcctgctctcgtcccg
ttggccggcaaccagagaccccgcctcatcctgaagaccaacggcagcagtccggatagt
gatggtacacaaccgaaaacaccactgacaccgcgtacatcgacaacgccaggccacgag
aagtgcacgttccaccacgacctggagctggaccacaagccgccgacgcgagaggccctc
cttccggacatggcacgctcgtatcgtctactcttgggcggcctgggcgagaatcccgat
cgccagggactgatcaagacgccggagcgggcagccaaggccatgctgtacttcaccaag
ggctacgaccagagtctcgaggatgttctcaatggcgccgttttcgacgaggatcatgac
gaaatggtggtggtcaaggatattgaaatgttctccatgtgcgagcatcatctggtgccc
ttctacggcaaagtttccatcggttatttgccgtgcaacaagattctcggactcagtaaa
ttggcacgcattgtcgaaatattttcgcgtcgcctgcaagtccaggagcgcttaactaag
cagatcgcagtggccgtgactcaggccgtgcaacccgctggagtagcagtggtcgtagag
ggagtccacatgtgcatggtgatgcgtggcgtgcagaagatcaacagcaaaactgttacc
tcaactatgctgggcgtgttccgagacgatcccaagacccgtgaggaattcctgaactta
gtcaatagcaaatag

DBGET integrated database retrieval system