KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9453
Entry
Dmel_CG9453       CDS       T00030                                 

Gene name
Spn42Da
Definition
(RefSeq) serpin 42Da, isoform B
  KO
K13963  serpin B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG9453 (Spn42Da)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I4: serpin family
   Dmel_CG9453 (Spn42Da)
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 49805
NCBI-ProteinID: NP_524955
FlyBase: FBgn0265137
UniProt: Q7K8Y5
Structure
PDB: 
4P0F 4P0O

Position
2R
AA seq 424 aa
MDYRLVPCGCWLLPLLGLALFPFPPVHTADVTMADAAHQEFARRLALFSINVYGKLSGQK
PGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAYQDSQ
ILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIK
DLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFR
YADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVAL
KLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGT
EAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWGSVVRLEENTFASSE
HDEL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggattatcgtttggtgccatgtggttgctggttgctccccctgctcggcctagccctc
ttcccgtttccaccggtccacacggctgacgtcaccatggctgacgccgcccaccaggag
ttcgcccgccggctggcccttttctctatcaacgtgtacggcaagctgtcggggcagaag
cccggcgagaacatcgtcttctcgcccttttccatccagacttgtgcggcgatggccagg
ctgggtgcagaaaacgagacggctacccagctggaccagggactgggcttggcctctagt
gacccagagcaaatcgcacacagttttcaccaggtgctggccgcctaccaggacagtcag
atcttgcgcatcgccaacaagattttcgtcatggatggctaccagctgcgccaggagttt
gatcagctgttatccaagcagttcctctcggcggctcagagcgtggacttttccaaaaat
gtacaagcagcggccaccatcaacaattgggttgagcagcgcaccaaccatctgatcaag
gaccttgtgccggctgatgtattgaactccgaatcgcgactcgtccttgtgaacgccatt
cacttcaagggcacctggcagcaccagttcgccaaacacttaacccgcccagacaccttt
cacctggatggggagcgaacagttcaggttccgatgatgagtttaaaggagcggttccgc
tacgccgatctgccggcgctagatgccatggctctggaactgccctacaaggactcagac
ctctctatgctgatcgtactgcccaacaccaagacgggtctgcccgctctggaggagaag
ttgcgcctcacgaccctctcgcagatcacgcagtcgttgtacgaaacaaaggtagcgctc
aaattgcccaggttcaaggcagagttccaagtggaattgtctgaggttttccagaagctg
ggcatgtcaaggatgttctccgatcaggctgaatttggaaaaatgctacaaagtccggag
ccattgaaagtgtcagccatcatacacaaggccttcattgaagtcaacgaggagggaacg
gaggctgcggccgccacgggcatggcggtgcgtaggaagcgcgctattatgtcgcctgag
gaaccaattgagttctttgccgaccatcctttcacctatgtccttgtgcatcagaaggat
ctgccattgttttggggctcagttgtgcggctcgaggaaaataccttcgcctccagcgag
catgatgagctgtga

DBGET integrated database retrieval system