KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9455
Entry
Dmel_CG9455       CDS       T00030                                 

Gene name
Spn42Dc
Definition
(RefSeq) serpin 42Dc, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 35600
NCBI-ProteinID: NP_001246154
FlyBase: FBgn0033113
UniProt: A1Z6R4
Position
2R
AA seq 403 aa
MSEPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEEL
RNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDF
FQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQ
KPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILL
PNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFS
DKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHP
FVFYIRNPQAVFFAGRFSNPKSGSGSGEEGLSREGFDANMYNV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgagcgaaccccaagaaggcagaaatcagtttgcgcgaaatctgatagatgtcattacc
aaagatgccctgcaacagagcaaagacccccacataaatacggttttctctccagcatcc
gtccaaagtgcattgaccttggcatttatgggggcttccggatctacagcagaggagcta
aggaatgggcttcagctaggaccaggagatcgccatcacatagccctaaacttcggagag
ttctggcgcacgagctgtaactacggcgacaggggacccgtgttgaagtccgtgaaccga
ttgtacgtcaacgattccttggaactgcttaccgagttcaacgagatcgccgtggacttc
ttccagtcgaaggccgaggcgacgaggttcgccgattcggagggagctacgcagctgatc
aacgactgggtggaacaggagacggagcataagatcaccaacctgcttcaatcggatgcc
gtgaacaacgaaacgagcgccctgctcatcaatgtcttgtactttaagggaaagtggcag
aaaccatttatgccagagaccacatcgattgaccatttccacgtggaccgggacactcac
gtgcaggtgaatatgatgtaccaagaggacaagttccggttcgcagaactgccacagctg
aaggctcgagctgtgcaactgccctatgattactcaaacattcacatgctaattctgctg
cccaacgaagtaaacggtctgcaggagttagagcagcaactcaacaccgtggatctagcc
gatattgacgcagcgctgaccttgcaggatgtcgagatctttctgcccaggatgtgcata
gagtacgacgtggacctcaagcaggtacttaatcagctgggtattacggaagtcttcagc
gataaggccaagctagacgggctctttacctcgcaaagtggccaaaaaatctcggcagca
aggcaccgcggctacatcgacgtaaatgaggcaggatcggaggcagcagcagtcagtttc
atgaagatagtacccatgatgctcaacatgaacaagaagctcttcaaggcggatcacccg
ttcgtcttttacatacgaaacccgcaggccgtcttcttcgccggccgattctcgaacccc
aagtctggatctggatcaggagaggagggcttgtcacgggaaggtttcgatgccaacatg
tacaatgtctaa

DBGET integrated database retrieval system