KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9456
Entry
Dmel_CG9456       CDS       T00030                                 

Gene name
Spn42Dd
Definition
(RefSeq) serpin 42Dd
  KO
K13963  serpin B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG9456 (Spn42Dd)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I4: serpin family
   Dmel_CG9456 (Spn42Dd)
SSDB
Motif
Pfam: Serpin RXLR_WY
Other DBs
NCBI-GeneID: 49808
NCBI-ProteinID: NP_001163067
FlyBase: FBgn0028988
UniProt: Q7YTY6
Position
2R
AA seq 372 aa
MYYLCIFLWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKEL
QSALGLPSEDKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPF
KSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWES
KFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLP
REVEGLSALEEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLS
GLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDA
NTIYFQGRVVSP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtattacttgtgcattttcctgtgggtcacttcagtggcatgtcagacctccaaagag
atctaccaactactttccaagagccatacaaaccagaacctcgtcgtctcgcccgtctcc
atagagaccatccttagcatggtcttcatgggcgcagaaggctcgacggccaaggagctg
cagagcgccttaggtttaccatcggaggacaaagaggcggtggcagccaggtacggtgct
ctcctcaacgatcttcagggacaggaggagggacccatactaaagctcgcgaatcgcatc
tacgtcaacgaccagtacagcctgaatcagaactacaacctcgctgtgagggaacccttc
aagtccgaggcggagtccattagtctgaccaatggccctgtggcggccgagagaatcaac
cagtgggtgctggatcagaccagtggtaaaatcaagggcatgatcgatcccggcagcatg
acgtccgacgtgaaggccttgctggtgaacgccatctactttaagggccagtgggagtcg
aagtttgacccagctaagaccagagcctccaccttccaagtaactgcgaacaagagtgtg
cccgtccagatgatggcgcaaatgggaacattcagggctaactacttccgcgatctagat
gcccaagtcatcgagctgccgtaccttaactccaacctgtccatgactatctttctgccc
cgagaagtggagggcttgagcgccctggaagagaagatcgttggcttcgccaggccgctg
gttgccaaggaggtctatcttaagctgcccaagtttaaaatcgaatttcgtgatgaactc
aaagagaccttagagaagctgggcatccgagagctattcaccgacaagtcagacttaagc
ggcttgttcgccgataagtcaggcggcaaagtcagtcaggtctcgcacaaggcgtttctg
gaggtgaacgaggagggagcggaggccgcaggtgccacatctgtggccgtcacaaatcga
gcgggattttctacgttcctcatggccgatcatccctttgccttcgtcattcgcgatgcg
aacaccatatatttccaggggcgtgttgtaagcccttga

DBGET integrated database retrieval system