KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9509
Entry
Dmel_CG9509       CDS       T00030                                 
Symbol
fiz
Name
(RefSeq) fezzik, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO NAD_binding_8 Lycopene_cycl Thi4 Pyr_redox_2 FAD_binding_2 HI0933_like TrkA_N DUF2080
Other DBs
NCBI-GeneID: 32420
NCBI-ProteinID: NP_001285254
FlyBase: FBgn0030594
UniProt: Q9VY04
Position
X:complement(14906334..14909708)
AA seq 646 aa
MSLDGGQNLNLDAAAIGPDPCGSVPATPGIGLWSGMVTILVQTLLSSQCLVSPASQWPVD
YVGDLSQPYDFVVIGAGSAGSVVASRLSENPDWRVLVLEAGGDPPVESELPALFFGLQHT
NFTWNYFTEPSDEACQAMKDGRCYWPRGKMLGGSGGVNAMLYVRGNRRDFDGWAAMGSTG
WSYDQVMPFFEKSVTPQGNATHPKGYVTLKPFERKDNDIHQMIIDGGRELGQPYVERFQE
GSDTGYSHVPGTVRQGQRMSTGKGYLGAVSKSRPNLHVVKNALVTKLDLDGETVKEVKFE
RAGVTHRVKVTKDVVISAGAIDSPALLLRSGIGPSKHLKELGIPVKLDLPGVGRNLQDHV
LVPVFLRLDEGQGEPMTDQAALDSIYQYLIYRAGPLAAHSTASLVGFINTNASSDGAYPD
TENHHMFFQRAHHASLELFTKGLSIQDQYTEVLQEYLKDSHLLCVFVLLSHPAARGELRL
KSTDPKVPPILTSNYLTESEDVATLMRGIRYIESLEQTKAFQDHLAEIARIPIKECDQIE
NYRSEEYWRCYAKYFTVTCYHQSGTVKMGPDYDNEACVSQRLKVHGLENLRVADASIMPA
VVSANTNAATVMIGERAAHFIQEDYQGEAVGANGGLWVPHMHADEF
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtcactagacggtggccagaatcttaacttggatgcggcggccattggcccagatcca
tgtggatccgttccagcaacacctggcattggattatggagtggcatggtgaccattctt
gtgcaaacgcttctatcgtcccagtgtctagtttcgcccgccagccagtggccagtggac
tatgttggcgatttgagtcaaccctacgattttgtggtcattggagcaggatctgcggga
tccgtggtggccagccggctgagcgagaatcccgactggagagtgctcgtcctggaggcg
ggcggtgatccacccgtcgaatctgagttgccggcactattctttggactgcagcacacg
aacttcacgtggaattacttcacagagcccagtgatgaggcctgtcaggcaatgaaagat
ggtcgctgctattggccacgaggcaaaatgctgggaggatcgggaggagtgaatgccatg
ctatatgttcgtggcaatcgcagggacttcgatggctgggcggcaatgggaagcacgggc
tggagctatgatcaagtgatgccgttcttcgaaaagtcggtcacgcctcaaggtaatgcc
acccatcctaagggttatgtaaccctaaaaccgttcgagcgaaaagataatgacatacat
caaatgatcatcgatggaggtcgggagttgggacagccatatgtggagagattccaagag
ggcagtgatacgggctattcccatgtgccgggtaccgtgagacaaggtcaaaggatgagc
acaggcaaaggatatttgggtgcagtctccaagtctcgtcccaatcttcatgtggtcaag
aatgcactggtcaccaaattggatctcgatggcgaaacggtgaaagaagttaaattcgaa
agggctggtgttacccatcgagtgaaagtgaccaaggatgtggtgatctcggccggcgcc
atcgattcaccagcacttctcctgcgttccggcattgggcccagtaaacatttgaaggag
ttgggcatacccgtaaaactagatcttccaggagttggacgcaatctccaggatcatgtc
cttgtgcccgtctttttgagactggatgagggtcaaggcgagccaatgacggatcaggct
gccctggatagcatatatcagtacctaatctatcgcgccggacctctggctgctcacagc
accgcctccttggtggggtttataaacacaaatgcgagtagcgatggtgcttatccggat
accgagaaccatcatatgttctttcagagagcccatcacgcttcgctagaactttttacc
aagggtctatccattcaagaccaatatacagaagtattgcaagaatatcttaaggactcc
catttgctgtgcgtttttgttctactctcacatcctgcggccagaggtgaattgcgtcta
aagagtacagatcccaaggtgccgccgatcctaaccagtaattatctaacggaatcggag
gatgtggccaccttgatgaggggcatacgctacatcgagtccctcgaacagacgaaagct
tttcaggatcatctggccgagatcgctaggattccgattaaagagtgcgatcaaatagag
aactaccgcagtgaggagtactggcgatgctatgccaaatacttcaccgtcacctgttac
catcaatcgggcaccgtgaaaatgggccccgactacgataacgaggcctgtgtgagtcag
cgtttgaaggtccatggattggagaaccttagagtggcggatgccagcataatgccagcg
gtggtcagtgccaatacaaatgcggccacggtgatgattggtgagagggcggcccacttc
atccaggaggattaccagggtgaggcagttggcgccaatggaggtctatgggtgccgcat
atgcatgcggatgaattctag

DBGET integrated database retrieval system