KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9514
Entry
Dmel_CG9514       CDS       T00030                                 
Symbol
CG9514
Name
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Lycopene_cycl NAD_binding_8 Pyr_redox_2 DAO Thi4
Other DBs
NCBI-GeneID: 32418
NCBI-ProteinID: NP_572981
FlyBase: FBgn0030592
UniProt: Q9VY06
Position
X:complement(14885952..14896891)
AA seq 726 aa
MVVVPALGAAAVSVGGLLFKASAASKAAAAAGVAAAGASKLGLAIAGAIKLATAVIGVGK
LTILPFLIAAIAYYNYDLFDPENRPFNVQQVDLAYDFIIIGGGSAGTVLASRLSEIPHWK
ILLLEAGGHETEISDVPLLSLYLHKSKMDWKYRTQPQPTACQAMKDKRCCWTRGKVLGGS
SVLNTMLYIRGNKRDFDQWADFGNPGWSYEDILPYFRKSEDQRNPYLARNKRYHGTGGLW
TVQDAPYNTPIGPAFLQAGEEMGYDIVDVNGEQQTGFGFYQFNMRRGSRSSTAKSFLRPA
RLRPNLHVALFSHVTKVLTDPHTKRATGVQFIRDGRLQNVYATREVILSAGAIGSPHLMM
LSGIGHGEELGRVGIPLVQHLPGVGQNLQDHIAVGGIAFLIDYPISIVMKRMVNINTALR
YAITEDGPLTSSIGLEAVAFINTKYANASDDWPDMNFMMTSASVMSDGGSQVKTAHGLTD
EFYQEVFGEVNNRDVFGVFPMMLRPKSRGYIKLASKNPLRYPLLYHNYLTHPDDVNVLRE
GVKAAVAMGETQAMKRFGARYWNKPVPNCKHLTLYTDDYWNCFIRQYTMTIYHMSGTAKM
GPPTDPWAVVDPQLRVYGIPGLRVIDASIMPAITNGNIHAPVVMIGEKGADMIKQLWLTP
TTAPVGVQGQGPSPRQGHNTSPAPPPRTQWRSKRSLNSTEADTETENSENLDIGTSPVHQ
WPLPRS
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggttgtagttccagctctaggcgccgccgccgtttccgtgggcggtctgctcttcaag
gcgagtgccgcatctaaggcggcggcggcagcgggcgtagcagcggcaggagcctccaaa
ttgggcctggccatcgccggtgctatcaaactggccaccgctgttattggcgttggtaaa
ctgaccatattgccctttctgatagcggctatagcctactataattacgatctcttcgat
ccggagaatcgaccattcaacgtgcagcaagtggatttggcctatgatttcatcatcatc
ggtggcggttcggcgggtactgttctggcctccagactatcggagataccgcactggaag
atcctgctcctggaggccggtggacatgagacggaaatctccgatgtgccgctgttgtcg
ttatatttgcataaaagcaaaatggattggaagtatcgcacccaaccacaaccgacagcc
tgtcaggcaatgaaggacaaacgctgctgttggacgagaggcaaagttttgggcggcagt
tcggtgctaaatacgatgctctacatcaggggaaataaacgagactttgaccagtgggcg
gattttggaaatcccggttggtcgtacgaggatatactgccctatttccggaagtctgag
gatcagcggaatccctatttggccaggaacaaacgctaccatggcacaggaggcctttgg
accgtccaggacgcgccatacaacacgcccattggaccggcatttctgcaggctggcgag
gaaatgggctacgatatcgtcgacgtgaatggagagcagcagacgggtttcggtttctat
cagttcaacatgcgtcgcggttcccgcagctccacggccaaatcatttttgcgaccagca
cgtctgcgacccaatcttcatgtggccctcttttcgcatgtcaccaaggtcctaaccgat
ccccatacgaaacgagcgactggagttcaatttatacgagacggaaggctgcaaaatgta
tatgccaccagggaggtgatcctgtcggcaggagccattggatcgccgcatctgatgatg
ttgtcgggcattggacacggcgaggaattgggcagagtgggcataccactggtgcaacat
ctgccgggcgtgggacagaatctacaggatcacattgccgttggcggcatagccttcctc
atcgactatcccatttcgattgtgatgaagagaatggttaatatcaataccgcacttagg
tatgccatcacagaagatggtcctttgacctccagcattggtttggaggcggtggctttt
attaacacaaagtacgccaatgccagtgacgattggccggatatgaactttatgatgacc
tcggcatcggtgatgtcggatggcggtagccaggtgaagactgcccacggtctgaccgat
gagttctaccaggaggtattcggggaggttaacaatcgcgatgtctttggcgttttcccc
atgatgctgagaccgaagagcaggggctacataaagctggcgtcgaaaaatcccctcaga
tatccgttgctctatcacaactacctcacccatccggatgatgtgaatgtgctgagggag
ggcgtcaaggcggcggtggccatgggtgaaacgcaggctatgaagagattcggtgctaga
tattggaacaaaccagtgccgaattgcaagcacctgaccctgtacaccgatgactattgg
aactgctttatcaggcagtatacgatgacgatataccatatgagtggtacggccaaaatg
ggaccacccacggatccttgggcagtggtggatccccagctgagagtttatggcataccc
ggactgagagttatagatgccagcataatgccggccattacgaatggcaatattcacgca
ccggtggtgatgatcggcgagaagggtgcggatatgataaagcaattgtggctaaccccc
acaacggcgccagtgggggttcaaggtcaggggccgagcccgcgtcaaggtcacaacacg
agcccagcgccaccaccgcgaacccagtggcggagtaaacgatcattaaactccacggaa
gcagacacagaaacggagaacagtgaaaacttggacattggaacatcacctgtacatcaa
tggccactgccaaggtcgtag

DBGET integrated database retrieval system