KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9518
Entry
Dmel_CG9518       CDS       T00030                                 
Symbol
CG9518
Name
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Lycopene_cycl DAO TrkA_N
Other DBs
NCBI-GeneID: 32416
NCBI-ProteinID: NP_001285249
FlyBase: FBgn0030590
UniProt: Q9VY08
Position
X:complement(14862989..14871181)
AA seq 703 aa
MVLNLLFITTVIKSTFGVVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQLNLYPEYDFI
VVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEPST
KACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKK
SEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMI
AQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVYR
IAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHVGMGGLTFL
VDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMA
PASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFH
YPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYL
ECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNA
PVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRDPDPASSNIQGIITLPNNITQGDSSNI
SDRSNMESNFSNSSHINNINFNSNSNSSNIESSSNFTLNYANS
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggtgctcaatctgctgttcataaccactgtgatcaagtccacatttggcgtggtgacc
acgggactctggctaattccactgatgctggccgccatcacatactatcgctatgatgcc
gtagatcccgagtcgaggccgctagatcaactgaatttgtatccagagtacgattttata
gtggtgggcagtggttcggccggagctgtggtggccaatcgtttgagcgaggtgaggaaa
tggaaagtactgctgatcgaagccggtccagatgaaaacgagatctctgatgtaccatcg
ctggcggcctatttgcaattgagcaaactggattgggcctacaagacggaaccctcgacg
aaggcgtgtttgggaatgcagaacaatcgttgcaattggccaagaggacgagtcttgggc
ggcagttcggtgctcaactatatgctctatgtgcgtggcaatcgccatgattacgatcac
tgggcatcgttgggcaatccaggctgggattacgacaatgtgttgcgttattttaagaaa
tcggaggataatcgtaatccctatttggccaacaacaagtatcatggtcgcggaggactg
ctaacggttcaggaatcaccgtggcattcacctttggttgccgcctttgtggaagccggt
actcagttgggctatgataatcgtgacattaatggcgccaaacaggcgggctttatgatt
gcccaaggaacgatacgtcgtggttcgagatgttccaccgccaaggcatttctgcgaccc
atacgcatgcgaaagaatttccatctgtcgatgaactcacatgtgaccagggtcatcatt
gaaccgggaacgatgagggcacaggccgtggaatttgtgaaacatggcaaagtgtatagg
atagcggccaggagggaggttatcatctcagctggtgccatcaataccccgcagctaatg
atgctctctggtttgggaccacgaaaacatctggaaaagcatggcattcgagtgttgcaa
gatctgcccgttggcgagaatatgcaggatcatgtgggaatgggtggactcacttttctg
gtcgataagcccgtggccattgtccaggatcgtttcaatcccacagccgtcacctttcag
tatgtgttgcgtgaacgaggaccgatgaccacattgggtggagtcgagggtctggccttt
gtgcacacaccctactcaaatcgcagtctcgattggccggatattcaatttcatatggca
ccggcttccattaactcagataatggagccagagtaaagaaggtgttgggcctgaaggaa
tcggtgtaccaagaggtctatcatcccatagccaacaaggatagttggacgataatgccg
ctgctattgaggccaagatcgcggggatctgttaaattacgatcggcgaatccctttcac
tatcccctaatcaatgccaactactttgacgatcccttggatgccaaaactttggtggaa
ggagccaagatagctcttcgcgtagctgaagcccaggttttcaagcaattcggatcgaga
ctgtggcgtaaaccgctgcccaattgcaaacagcataaattcctatccgatgcctatttg
gagtgccatgtgcgcaccatttcgatgaccatctaccatccatgtggcactgcgaagatg
ggacccgcctgggatcccgaggctgtggtggatccacgcttgagggtctatggagttcgc
ggtctcagggtgattgatgccagcattatgccaacgattagtagtgggaataccaatgca
ccggttataatgatagctgaaaagggcgcagatctcatcaaggaagattggctaacaaat
cccgagtacaaagtaaagcggcaggcaaatagacttagagatccagatcctgctagtagt
aacattcagggcatcatcacattgcccaacaatatcactcaaggcgacagcagcaacatc
agtgacaggagcaacatggagagcaacttcagcaacagcagtcacataaacaacatcaat
tttaacagcaacagcaacagcagcaacattgaaagcagcagcaacttcacactcaactat
gcgaatagttag

DBGET integrated database retrieval system