KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9593
Entry
Dmel_CG9593       CDS       T00030                                 

Gene name
CG9593
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
Motif
Pfam: Fibrinogen_C
Other DBs
NCBI-GeneID: 41912
NCBI-ProteinID: NP_650493
FlyBase: FBgn0038365
UniProt: Q9VF34
Position
3R
AA seq 382 aa
MMKFSLLFLLAWSCVFLGSTGSLNRIGNSDIGFKSLEELVLIRKTLAAQALKLRGLEINL
HRVLSKVVLLADAVVQVPGRYSSKEDPLAVLSERLNLLLERLNQEERISTNLLELKEWST
KVCQEPSPSQTLPKELTEEKDEPKVDFYQPAKSDCHELDEGVRVDGVYRFLVPERNEVQR
DLYERYCAFATDGPAWTVIQSRGGSFDPHENFNRSWDEYRAGFGNLSRDFWFGNEFAHKI
LYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQLSVAGEFRGSLPDALEQHNRMDF
STYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEHGVHQRASPAIIWMNWRTGTDK
PKSSRMMIRPVNPTPGDNSDGD
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgatgaagttttcattgctttttctgctggcctggagctgtgtgtttctgggaagcacg
ggttctctaaatcggattgggaattctgatataggctttaaatccttggaggagctagtc
ttgattagaaagactttggctgcacaggcactaaagctaaggggcttggagataaatctg
catcgcgtgctcagcaaggtggtgttactcgccgatgcagttgtgcaagtacctggaaga
tactcctccaaagaagatccccttgccgttctatctgaacgtctaaatttgttgctggag
cgactgaaccaggaagaaagaatatctacgaatttgctggaactcaaagagtggtcaact
aaagtgtgccaagaaccttccccaagccagaccttaccaaaggaacttactgaagaaaag
gacgagccgaaagtggacttttaccagcccgccaaatccgattgccatgagcttgacgaa
ggtgtccgggtggatggcgtctataggtttctggttccggagcgcaatgaagtccagcgt
gatttgtacgagcgttattgcgccttcgccaccgacggccccgcctggacagtgatccag
agtagaggcggctccttcgatccgcacgaaaatttcaatcgcagctgggacgagtatcgc
gcgggttttggtaacttatcccgagacttctggtttggcaacgagttcgcgcacaagatt
ctctaccgcgacgatcatgagctgagaattgagctgcaggaggcaggggaaccgctggat
tgggcggagtatccactcttctggctagacagcgagagttataactatcagctttcggtg
gctggtgaattccgtggttcactaccggacgctctggagcagcacaatcggatggatttc
agcacttacgatcggcgaaggaaccacgcgaaatcggcagattccacctgtggcgaggat
tacggtggtggctggtggtttgatcgctgcacacagtgcaatctgaatggagaacatggt
gtccaccagagagcaagtccagccattatctggatgaactggcggaccgggaccgataaa
ccgaagagctcgcggatgatgattcgacccgtaaatcccactccgggcgataactctgat
ggggattag

DBGET integrated database retrieval system