KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9695
Entry
Dmel_CG9695       CDS       T00030                                 

Gene name
Dab
Definition
(RefSeq) disabled, isoform A
  KO
K12475  disabled homolog 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG9695 (Dab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG9695 (Dab)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    Dmel_CG9695 (Dab)
Motif
Pfam: PID PTB
Other DBs
NCBI-GeneID: 39866
NCBI-ProteinID: NP_524119
FlyBase: FBgn0000414
UniProt: P98081
Position
3L
AA seq 2224 aa
MVKSLVAKLSTASSNLSLASTFGGGSGAAEETNYAKHRNDPGRFFGDGVQFKAKLIGILE
VGEARGDRMCQEALQDLKMAIRAAGEHKQRITIHVTIDGLRLRDEKTGDSLYHHPVHKIS
FIAQDMTDSRAFGYIFGSPDSGHRFFGIKTDKAASQVVLAMRDLFQVVFELKKKEIEMAR
QQIQGKSLHDHSSQLASLSSLKSSGLGGMGLGHSDLASGGISSGHALTLLGSSLSTTNGT
SRLGVSLDVAKASGSAAKEVSPESVADLVDLEQELTSLQRGISQMERITPNEPTTSSTGG
AGHPSLAKSASEDDPFGDSFIYVPSYSILPPPPDSGRNRHKPPNKTPDAVTSLDAMLSPP
PGTSSSHGSASAGLQAADNDDDNWLQELDQQNDVFDTSKVVSSSGLGSVLAMAPLASSES
TATPTQQLTEVAAGSGPLADLDIGLSTALGNEEQTSTILSLDAFTDLDPLGTGRTRPYVD
KKYFFQELKNPPKKLLKELSSGSQAGLGLGLSLGQLDGLFPEDSTTISTTTTTATNITAG
NPQQNSANTLTSTASTAASLGQLLSTVALNPDPLPAPISIPTSISHSITPSAELKLLLGH
VTNPPNPTGHYYTTEPPTLNSLENPHPPADPVLLPRDTDPFSPTRKKSDPDPFQESDLFA
KLDAFEFEAPPAVPAPSIPNLATETKANVFNGPLQVQLPPEKELQLQQPPSTVRNRPTAS
VSALPSGGALDVISSISNKKMPHLFGQARSFGKSGSDIGSSVNMRRLQESDSLSETEAAP
EPPPRPDSTPYSEPPPLPPKKQFSDLVIRPSPANTTQPPTSGRYEYLNSNVTARRTASSV
DAPPIPLPSRRVGRSDGCFPGPGRPRKPGHTEDDYLAPLGAPPPLLPPPSQGSSARARPQ
RQASLGRPQDIYENKAEILQAQAQAQAQAPEVAPSSNTLAPDITLTQLLTLGMDDLAIKL
NVPASKLSTMTLVQLTAYLSEYLSSEKSQVHSQERRSSPANTAPAPASTAAVFKVNFDQQ
TSFVAKFDDTFGEDEPVMPSGSSDSTFVANFANFNDAPTPVPTVSPVVATVPSADRYAVF
REIIDQELQQQQQETDLMGDLTPPPVDETQAKEISEGLEVNNVGAELPIDALDVKPAPKI
DTKITEVVAQAKDRYAALRDIILVENLFDKPAIATDTQPEKEKDLLQDFPEFSDEFNEDH
DLRQIMDHQNVQTHARDRHGLVDSRGFPTEPSSSALTVGDYDEDEDADAGGESSLDSNEK
DAEPVSGQDQYEKLSTSTQQLDAAAPALEDVQQLQQQSLPPKQDQKFLSILTAPGGGTKD
DIEIDELMHRAISNLSLDSRDRVSPATSSAAPSRGAPGLHTPSQFNDVSTSPIPLQKPGM
GPSPVPSQLSAVSQLIDTATKQMMGDKDREKQSWATFDSPKAKGKARLTLPPPPPPASNT
SQPDTVESPCSSDPRDDGWSKQQRRWAKKERQQTSSSSRDLSPWDDETPEYLKRRQLAAA
QMAHPHQPPMQAPPQHTDRHGYYMRHARRMNSCDEDYDYDGEFVARRDQPQHQQQQRKFK
HGLSRSRDNFELESPSWYHHPAHHTWSPQEIEQVRVRSFDRTAYERSSYGPPPPIYDKRG
QLRGKYRGDHRDRERERDRDREYRDYARPSYDFDYENVYEERGGRSPLAYKPGRGGGDYL
YDRERDRDRERDRKSFDRESLESYESATRRRRSFGSGNDVYGSLDSRDDYRGDRERDRER
DREQMKTRSLRKPTTTSGKLRISGDIDYEQDSEQDFQQRSGVRSLQRPNQLGGDVVLPSN
AVVGPQRLRKSSGSSPWDGEEPALPGQKSWKRPASAAETERRLAESRRAVALGQTPSDGE
KERRFRKKTRARSAKDLATVGAPSASTSAPSRSSYGRGIRDNYDYICPGQRNDDDDDDDE
DYVDDEPPTDEDKFERLNRRRHEMHQRMLESERRQMERHQPPSLAKLPGQNRTRGVVANS
DYGFVDSYEQTPTPTPRSNASSTGPGGLMMSGGESSAGVTSSKFNFDDGFESDFNQSSPP
PAPAGTASSCNSTPAGPVSANANNGGSKSLFRFSNDFSDREKREQFEMDTPPTSTPPITQ
KLRFDDNVKVSQFDDAAFEDDFAKASFDFEKEQAGSATAGAGGSGAMSRKQNMRTSKLQQ
RQELIKKSESVNIFAKKQEDPFEDDEFFKSPDQEQAMDQHNDDTEGGKFQWSEDANFAKF
DENM
NT seq 6675 nt   +upstreamnt  +downstreamnt
atggtcaagtccctggtggccaagttgtccacagcctcctccaatctctcgttggccagc
acctttggcggcggcagcggcgcggcagaggaaacgaattacgcaaaacatcgcaatgat
ccgggacgctttttcggcgatggcgttcagttcaaggcaaagctcatcggcattctggag
gtgggcgaggcccgaggtgatcggatgtgccaggaggcgctgcaagatctcaaaatggcc
atccgggcggctggagagcacaagcagcggataaccatccatgtgaccatcgatggtctg
cggctgagggatgagaaaacgggtgactccctgtaccatcatccggtgcataagatctcc
ttcatcgcgcaggatatgactgactcgagggcctttggctatatcttcggatcgccggac
agtggtcaccggttcttcggcatcaagacggacaaggcggccagccaggtggtgctggcc
atgcgcgatctcttccaggtagttttcgagctaaagaaaaaggagattgagatggcgcgc
cagcagatccagggtaagtccctgcacgaccattccagccagctggcctccctgtcgtcg
ctgaagtcctccggcctgggtggcatgggtctgggccactcggatttggccagcggagga
atctcatccggccatgccctcaccctgctgggcagtagtcttagcaccacgaatggaacg
agcaggctgggcgtgagtcttgacgtggccaaggcatccggatcggcggccaaagaggtc
tctccggaatccgtggccgatcttgtggacttggagcaggagcttacctcgcttcagcgg
ggaatcagtcagatggaacggataacgccaaacgagccgaccaccagtagcactggtggt
gctggccatccatctctagcgaaatcagccagcgaggacgatcctttcggagactcgttt
atctatgtgccctcgtatagcatactgccaccgccacctgattccggacgcaacaggcac
aagccgcccaacaaaacacctgatgcggtgaccagtttggatgcaatgctttcgccacct
cctggtacaagtagctcccacggctcagcctccgctggactacaggctgcagataacgac
gatgacaactggctgcaggaactggaccaacaaaatgatgtcttcgacacgtccaaagtg
gtgagcagcagtggattgggttcggttttggccatggctccgctggcctccagcgaatcc
acggccactcccacccaacaactgacggaggttgctgcaggatctggacctctggctgat
ctggatattggactaagtacggccttgggaaatgaggaacagacctccaccattttgtca
ttggatgcgttcacggatttggatccgctaggcacaggacgcaccaggccgtatgtcgat
aagaaatacttcttccaagagctgaagaatccgccgaagaagctgctcaaggagctcagc
tccggcagccaggcgggtctcggtctgggtctctctctgggtcagttggatggcctcttt
ccggaggatagcaccaccatctccacaaccaccaccacagctactaacatcaccgcagga
aatccgcaacagaactcggctaacacactaacatccaccgctagcaccgccgccagtctg
ggacagctcctgtccacggttgctctcaatcccgatccgctgcccgctcccatttccata
cccacatctatttcccattcgatcaccccgagcgctgagctgaaactgttgcttggccat
gtcactaatccacctaatcccaccggccactattataccacagaaccgccaacgctgaac
tcgctggagaatccccatccgccggcggatcccgtacttctgcccagggatacggatccg
ttctcgcccactcggaaaaagagcgatccagatcccttccaggaaagcgatctctttgcc
aaactggatgctttcgagttcgaggctccgccggcggttccagctccctcgattccaaat
ttggccacggagacaaaagcgaatgtattcaatggaccacttcaggtgcaattgccacca
gagaaggagttgcagcttcagcagcctccgagtacggtgaggaaccgtcccacagcatct
gtttccgcacttccaagtggcggagcccttgatgtgatctccagtataagcaacaagaag
atgccgcacctttttggccaggccagatcatttggcaaatctggttcggatattggttca
agtgttaacatgcgccgcctgcaggagagcgattcgttgagtgaaacagaggcagctccc
gagccaccgccgcgtccagactcgactccgtactcggaacctccgcccctgccacccaag
aagcagttcagcgatctggtcatccgaccttcacctgcaaataccactcaaccgccaact
agcggaaggtatgagtatttgaacagtaatgtcacggcaagaaggactgcctcctccgtt
gacgcaccacccattccattgccatcgcgccgtgttggtcgctctgatggctgctttccg
ggtccgggaaggccaagaaaacctggacacaccgaggatgattatctagctccgttggga
gctccaccgccattgctgccgccacccagccaaggatcctcggctcgcgcgagacctcaa
cggcaggcttcgctaggcaggccgcaggatatctacgaaaacaaggcggagattctgcag
gctcaagcacaggcgcaggcccaggccccggaagtagcgccctctagcaataccttggct
cccgatatcaccctaactcaattgctcaccctgggaatggatgatttggctatcaaactg
aacgttcccgccagcaaactgagcaccatgactctggtccagttgacagcctatctctcc
gagtatttgtccagtgaaaaaagccaagttcacagtcaagagaggagatcttcgccagca
aacacagctcctgcaccagcttccacggcagctgtgtttaaggttaattttgatcagcag
acctcctttgtggccaagttcgacgacacttttggcgaagacgaaccagtgatgccttcg
ggttcttcggactccacctttgtggctaacttcgccaactttaacgatgcaccaactccg
gtgccgacagtatcgccagttgttgcgacagtgccctcagcagatcggtatgccgtattt
cgcgagatcatcgatcaggagcttcagcagcaacagcaggaaacggatcttatgggcgat
ttgacaccaccgccagtggatgagacccaggccaaggaaatttcagagggcttggaggtg
aacaatgtgggtgcggagctaccaattgatgccttagatgtcaaacctgcgccgaagatt
gacacaaaaatcaccgaagttgtcgcccaggccaaagatcgttacgcagctctgcgggac
ataatcctagtggagaatctctttgataaaccagcaatagcaaccgacactcagcctgag
aaggaaaaggatctgttgcaagactttcctgagttcagtgatgagttcaacgaggatcat
gaccttcgccaaattatggatcatcagaatgttcagactcatgcccgcgatcgtcatggc
ttggtcgacagcaggggctttccaacagagccttcgtcttccgctctgaccgtgggcgat
tatgatgaggacgaggatgctgatgcgggtggtgagagcagtctagatagcaatgaaaag
gacgcagagcctgtcagcggtcaggatcagtatgaaaagctatccacgtcgacgcaacaa
ctagatgcagctgctccggctctagaggatgtgcagcagctgcagcagcaatccctgcct
ccaaagcaggatcaaaaattcctctccatcctaacggctcccggtggtggaacgaaagat
gacatcgagatcgacgagctcatgcatcgtgcaatttcgaatctctccctggactcaagg
gatcgagtttcgcccgccacctcctcggcagctccatcacgtggggctcccggcttgcac
acgccctcgcaattcaatgatgtcagcacgtcgccgattcccctccagaaaccaggcatg
ggcccatcgcctgtgccgtcgcagctttcggccgtgtcccaactcatcgataccgcaacc
aaacaaatgatgggcgacaaggatcgggaaaagcaatcctgggctacattcgattccccg
aaggcaaaaggcaaggctaggctaacgcttccgccgccaccacctcctgcatccaacact
tcgcaaccggatacggtagaatcgccttgcagttcggatccccgggatgacggctggtca
aagcaacagcgtcgttgggcgaagaaggagcgccagcagacatcctcatcatcccgagac
ctaagtccctgggacgatgaaacgccggagtatctgaagcggcgacagttggccgccgct
caaatggctcatccccatcagccccctatgcaagctccacctcagcatacggatcggcat
ggatactacatgcgacacgccaggcgaatgaactcttgcgacgaggactacgactacgat
ggggaattcgttgcacgccgagatcagccacaacatcaacagcagcagcgaaagttcaag
cacggactttctcgcagcagggataactttgaattggaatcccccagctggtatcatcac
ccggcgcaccacacatggtcgcctcaggagattgagcaggtgcgcgtacgatctttcgat
cgtactgcttacgagcgatccagctatggcccaccgccacccatctacgacaaacgtgga
caactgagaggcaaatatcgcggagatcacagggatagggaacgagagcgtgatcgcgac
cgagagtatcgggattatgctcgtccaagctacgatttcgactacgaaaacgtctacgag
gagcgtggaggtcgttcaccgttggcctacaagccaggaagaggtggtggtgattatctg
tatgacagagaaagggacagggatcgggagcgcgatcgaaaatccttcgatcgggaaagt
ctcgagtcctatgagagcgccacccgtcgtcgtcgcagttttggtagtggaaacgatgtt
tatggcagcctagatagtcgcgatgattaccgtggcgatagggaaagggatcgtgaacgt
gatcgcgagcagatgaagacccgttcattacgaaagccaacaactacgtctggaaagctc
cggataagtggcgacattgattacgagcaggactcggagcaggacttccagcagcgatct
ggagtacgaagcctgcagcgtcccaatcagctaggcggtgatgtggtgctgccctccaat
gcggtagtgggtccacagcgattgcgcaaaagcagcggctccagtccctgggacggagag
gaaccggccttgcctggtcagaaatcttggaagcgtccagccagcgctgctgaaaccgaa
aggcgactggctgagagtcgcagagcggtagctttgggtcaaactccctccgatggagaa
aaagaacgaagattccgcaagaaaacccgagcccgcagtgccaaagatttagccaccgtc
ggtgctcccagcgctagtacttctgccccgtccagatcgagctatgggcgtggcatcagg
gataactatgactatatatgtccaggccagcgtaacgatgacgacgacgatgatgatgag
gactacgtggatgatgaaccgccaacggatgaggataagttcgagaggttgaaccgccgg
cgacatgagatgcaccagcggatgctggagtccgaacgtcggcaaatggaacgccatcag
ccgccatcgctggcgaagcttccgggccagaatcgtacacgaggcgtcgtggctaacagt
gactatggttttgtggacagttacgagcagactccaactcccacgccacgttcgaatgcc
agtagcactggaccgggtggcctgatgatgagtggcggggagtcctccgctggagttaca
agttccaagttcaattttgacgatggatttgagtcagattttaatcagagctctccgccg
ccggcgccagcaggtaccgcctccagttgcaattccacgccggcgggtccagtttcggca
aatgcgaacaacggcggatcgaagagcctgttccgcttctccaatgatttttcggatcgc
gagaaacgggagcagtttgagatggatacaccgccaacctcaacaccaccaattacgcaa
aaactgcgatttgacgataatgttaaggtctcccaattcgatgatgctgcctttgaggat
gacttcgccaaggcatcattcgattttgaaaaggaacaagcgggttctgccacagcaggt
gccggaggatctggtgctatgagcaggaagcaaaatatgcgaaccagcaagctgcagcag
cgccaggagctcatcaagaaatccgagtcggtaaacatatttgccaaaaagcaggaggat
cccttcgaggatgacgagttctttaaatcaccagaccaggaacaggccatggatcagcac
aatgatgacactgagggcggcaaatttcagtggagcgaggacgcgaactttgcaaagttc
gatgaaaacatgtga

DBGET integrated database retrieval system