KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9858
Entry
Dmel_CG9858       CDS       T00030                                 

Symbol
clt
Name
(RefSeq) cricklet
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9 Esterase
Other DBs
NCBI-GeneID: 117300
NCBI-ProteinID: NP_536784
FlyBase: FBgn0000326
UniProt: Q9W2F4
Position
2R:complement(21617061..21619079)
AA seq 562 aa
MLLRPCGRLIFTRFCSSMKVKVPVKQGVLVGRQKKLVNGLEYNSFLGVPYAEPPVGELRF
RSPRPLERFQKQELDCSKEGNVSYQRDPFTLEVAGSEDCLFLNVYAPKVKSTRTPLPVMV
WIHGGGFFFGNGNSDFHFPAKLMEQEVIVVTLNYRLGALGFLSLPEEGIHGNMGLKDQRL
ALEWVQENIASFNGDPNNVTLFGESAGGSSVHLHTFARHAKRLFHKAIMQSGTANMEWVF
QNEAPAKTRRLAELLGGGDFGGDSKALLTFLQSEKATPTAILANTLKVLSPDERRRHLPF
AFKPVVEDSSSPDRFLEQDIMELMHKKDCLGSMPVIMGYNSAEGLAIVVKAKQKLEAYED
DLARLVPRNLVLDPQAPEAQEAASDIRAFFFNGQALSKENMDNLVDLFSDYHFSMDLQRA
VEIHASCQTQSPLYFYRLDYVGGRNLYKKIFQNEDLRGVAHADDICYLFQMAGDETEMNR
DDLMVTERLCEMWANFARDGKPSPIWKPVKKPHNGEPIQLDCLLIDRELKMCSNPDGERM
DFWRSMYRRYRSENFEAVRAKL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcttcttcgtccgtgtggaagactaatctttaccaggttttgcagcagcatgaaggtg
aaagtgccagtgaaacaaggcgttttggtgggccggcaaaagaagctggtcaatggattg
gagtacaacagtttcctgggtgttccctacgcggaaccaccagtgggagagcttcgtttc
cgcagcccgcggccattggagcgctttcaaaagcaggagctggactgcagcaaggagggc
aacgtgtcttaccagcgagatccgtttactttggaggtggccggctccgaggactgcctt
ttccttaatgtatatgcacctaaagtcaaaagtacgcggactcctttacccgtgatggtc
tggattcatggtggaggcttcttcttcggcaacggcaacagtgacttccactttcccgcc
aagctcatggagcaggaggtcattgtggtcaccctgaattaccgacttggagcgcttggt
ttccttagtctgcccgaggagggaatacacggcaatatggggcttaaggatcaacgtctg
gccctcgaatgggtgcaggagaacatagccagcttcaatggcgatccgaataacgtaacg
ctcttcggcgagagtgcgggcggttcttcagtacatctgcacacttttgcccggcatgcc
aagcgactattccacaaggctatcatgcagagtggaacagcgaacatggaatgggttttc
cagaacgaggcacctgccaagacccgacgactggctgaactcctgggtggtggtgatttt
ggcggcgacagcaaagcacttttgaccttcctgcagtcagagaaggcaacacccactgcc
attttggctaacacattgaaagtcttaagccccgatgagcgacgacgtcacctgcccttt
gcattcaagccagtagtggaggacagcagcagtccggatcgttttcttgagcaggacatc
atggagctgatgcacaaaaaagactgcctcggcagtatgccagtgataatgggttacaac
tccgccgaggggttggctattgtagtaaaggcgaagcaaaaactggaggcctacgaagat
gacttggccaggttggttccccgcaatctggtgctagatccacaggctccagaggcacag
gaagctgcttccgacatacgagccttcttctttaacgggcaggcgctgtctaaggaaaac
atggataacctggtggacctgttctccgactatcatttcagcatggatctgcagcgcgca
gtggagattcacgctagctgccaaacgcaatctcctctgtacttctatcgcttggactat
gtgggcggtcgtaatctgtacaagaagatcttccaaaacgaagacctgcgtggagtggct
catgccgatgatatttgctacctgttccagatggcaggtgacgagaccgagatgaatagg
gatgacttgatggtcacggaacggctatgtgaaatgtgggcgaacttcgcgcgcgatgga
aaaccttcgcccatttggaaaccagtcaagaagccacacaatggcgagcccatccaactc
gactgcctgctaatcgatcgggagctgaagatgtgcagcaatccggatggcgaaagaatg
gacttttggaggagcatgtaccggagatacaggagcgaaaatttcgaagctgtgagagct
aaactttaa

DBGET integrated database retrieval system