KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9885Help
Entry
Dmel_CG9885       CDS       T00030                                 

Gene name
dpp
Definition
(RefSeq) decapentaplegic, isoform A
  KO
K04662  bone morphogenetic protein 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04341  Hedgehog signaling pathway - fly
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9885 (dpp)
   04341 Hedgehog signaling pathway - fly
    Dmel_CG9885 (dpp)
   04350 TGF-beta signaling pathway
    Dmel_CG9885 (dpp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dme04052]
    Dmel_CG9885 (dpp)
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG9885 (dpp)
Cytokines and growth factors [BR:dme04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   Dmel_CG9885 (dpp)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Haparin
  Morphogens
   Dmel_CG9885 (dpp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 33432
NCBI-ProteinID: NP_477311
FlyBase: FBgn0000490
UniProt: P07713
Position
2L
AA seq 588 aa AA seqDB search
MRAWLLLLAVLATFQTIVRVASTEDISQRFIAAIAPVAAHIPLASASGSGSGRSGSRSVG
ASTSTALAKAFNPFSEPASFSDSDKSHRSKTNKKPSKSDANRQFNEVHKPRTDQLENSKN
KSKQLVNKPNHNKMAVKEQRSHHKKSHHHRSHQPKQASASTESHQSSSIESIFVEEPTLV
LDREVASINVPANAKAIIAEQGPSTYSKEALIKDKLKPDPSTLVEIEKSLLSLFNMKRPP
KIDRSKIIIPEPMKKLYAEIMGHELDSVNIPKPGLLTKSANTVRSFTHKDSKIDDRFPHH
HRFRLHFDVKSIPADEKLKAAELQLTRDALSQQVVASRSSANRTRYQVLVYDITRVGVRG
QREPSYLLLDTKTVRLNSTDTVSLDVQPAVDRWLASPQRNYGLLVEVRTVRSLKPAPHHH
VRLRRSADEAHERWQHKQPLLFTYTDDGRHKARSIRDVSGGEGGGKGGRNKRQPRRPTRR
KNHDDTCRRHSLYVDFSDVGWDDWIVAPLGYDAYYCHGKCPFPLADHFNSTNHAVVQTLV
NNMNPGKVPKACCVPTQLDSVAMLYLNDQSTVVLKNYQEMTVVGCGCR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcatggcttctactcctcgcagtgctggcgacttttcaaacgattgttcgagtt
gctagcaccgaggatatatcccagagattcatcgccgccatagcgcccgttgccgctcat
attccgctggcatcagcatcaggatcaggatcaggacgatctggatctagatcggtagga
gcctcgaccagcacagcattagcaaaagcatttaatccattcagcgagcccgcctcgttc
agtgatagtgataaaagccatcggagtaaaacaaacaaaaaacctagcaaaagtgacgcg
aaccgacagttcaacgaagtgcataagccaagaacagaccaattagaaaattccaaaaat
aagtctaaacaattagttaataaacccaaccacaacaaaatggctgtcaaggagcagagg
agccaccacaagaagagccaccaccatcgcagccaccagccaaagcaggccagtgcatcc
acagaatctcatcaatcctcgtcgattgaatcaatcttcgtggaggagccgacgctggtg
ctcgaccgcgaggtggcctccatcaacgtgcccgccaacgccaaggccatcatcgccgag
cagggcccgtccacctacagcaaggaggcgctcatcaaggacaagctgaagccagacccc
tccactctagtcgagatcgagaagagcctgctctcgctgttcaacatgaagcggccgccc
aagatcgaccgctccaagatcatcatccccgagccgatgaagaagctctacgccgagatc
atgggccacgagctcgactcggtcaacatccccaagccgggtctgctgaccaagtcggcc
aacacagtgcgaagttttacacacaaagatagtaaaatcgacgatcgatttccgcaccac
caccggtttcggctgcacttcgacgtgaagagcattcccgccgacgagaagctgaaggcg
gcggagctgcagctgacccgggacgcactcagtcaacaggtggtggccagcagatcgtcg
gcgaatcggacgcgctaccaggtgcttgtctacgacatcacgcgcgtcggggtgcgtggt
cagcgggagccgagctatctgctgttggacaccaagacggtccggcttaacagcacggac
acggtgagcctcgatgtccagccggccgtggaccggtggctggcgagtccgcagcgcaac
tacggactgctggtggaggtgcggacggtccgctccctgaagccggccccacaccaccat
gtacgcctgcgccgcagcgcggacgaggcgcacgagcggtggcagcacaagcagccgctc
ctgttcacctacacggacgacgggcggcacaaggcgcgctccattcgggacgtgtctggc
ggagagggcggtggcaagggcggccggaacaagcggcagccgagacggcctacgaggcgc
aagaaccacgacgacacctgccggcggcactcgctgtacgtggacttctcggacgtgggc
tgggacgactggattgtggcgcctctgggctacgatgcatattactgccacgggaagtgc
cccttcccgctggccgaccactttaactcgaccaatcacgccgtggtgcagaccctggtc
aacaatatgaatcccggcaaggtgccgaaggcgtgctgcgtgcccacgcaactggacagc
gtggccatgctctatctcaacgaccaaagtacggtggtgctgaagaactaccaggagatg
accgtggtgggctgtggctgtcgatag

DBGET integrated database retrieval system