KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9887
Entry
Dmel_CG9887       CDS       T00030                                 

Gene name
VGlut
Definition
(RefSeq) vesicular glutamate transporter, isoform B
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG9887 (VGlut)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   Dmel_CG9887 (VGlut)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    Dmel_CG9887 (VGlut)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 33427
NCBI-ProteinID: NP_001245848
FlyBase: FBgn0031424
UniProt: Q9VQC0
Position
2L
AA seq 632 aa
MKGLTAFKEKATGVFGGLKPNMEKFEISQSYHGGHGGYEEMEGGDREGRGPGGGHAYDDD
DDRPDSPASFEEIERPPLRKIDKYCKAECPCMPARYTIATMACVGFMIAFGMRCNMSAAK
LKGEHNGTVFMNWTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLH
LFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAG
VVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKS
LGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVE
EAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHS
STATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDG
LIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPWAEPPAEEQKVWAPPPGAITNT
DPSQAGMLGDYMKETSFGAPEYTEQSQMQQSTAISYGATGHVANNPFAMASGAPPIAEED
APPTYGDVTNPGQYGYTQGQMPSYDPQGYQQQ
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgaagggtctgacggcgtttaaggagaaggcaacgggcgtgtttggcggcctgaagccc
aatatggagaagtttgagatatcgcagagctatcatggtggccacggtggctacgaggaa
atggaggggggcgaccgggagggccgcggaccaggcggcggccacgcctacgacgacgat
gacgaccggcccgactcgcccgcctccttcgaggagatcgagcgcccgccgctccgcaag
atcgacaagtactgcaaggcggagtgtccttgcatgccggcccgctacaccatcgccacc
atggcctgcgtgggattcatgatcgccttcggcatgaggtgcaatatgtcggcggccaag
ctcaaaggggagcacaatgggactgtgttcatgaactggacggtcgccgtggagagccat
gtggactcgtccttcttctggggctatctggtgacgcagattcccggcggcttcatcgcc
tccaagttcccggccaacaagatattcggactgtccatcgtgagctccgccacgctgcat
ctcttcgtgccattcgccatgaccctgatgcacggtcatgtggtgatttgcgtgagggtc
ctgcaaggactcttcgagggcgttacctatccagcttgccatggtatctggcgtttctgg
gcgccgcccatggagcgctcccgactggcgacgctggccttttccggttcctatgcgggc
gtggtggttggacttccgctctccggacttctggccgatgccgtgggctaccaggcgccg
ttctacgcctacggggtgttcggaatcatatggtacatgttctggatatggttgtgcttc
gagaacccgcgcaaacatccggccatcagcatacccgagttgaagtacatcgagaaatcg
ctcggggagtcggctcatcccacgatgccatccctgaagacgactccgtggcgggaaatg
atgcgctcgatgccggtctacgccatcattgtggccaacttctgccgctcctggaacttc
tacctcctggtgctgttccagtcctcgttcctcaagcacaagttcggttttaaggtggag
gaggcgggcttcgtgggctcgctgccccacttgatcatgactacgatagttccatttggc
ggcatgttggcggatcacctgcgaaagaatggtatcctgtccaccaccaatgtgcgcaag
ctcttcaattgcggcggctttggcatggagggtctgtttttcctattcgtggcacattcc
tcaacggcgacgggtgccatgtttgccttgacctgcggcgtggccttcagtggctttgcc
atatccggttataatgtcaatcacctggatattgctcctcgttatgctagtatattgatg
ggtctttcgaatggaattggtactctggccggcatcattgtgccctatgcccttgatggc
ctcatccaagctaatcctaccgggtgttggactacagtcttcaccctggccgcctgtgtt
catttggttggctgcactttctatggtattttcgcatctggagagctgcagccgtgggcg
gaacctccggccgaggagcaaaaggtgtgggctccaccaccaggtgccattaccaacacg
gatcctagccaggcgggcatgttgggcgactacatgaaggaaacctcattcggtgccccc
gagtacactgagcagagccaaatgcagcagtcgactgccattagctacggcgccacagga
cacgtggccaacaatcccttcgccatggccagtggtgctccgcccattgcggaggaggat
gccccaccgacctacggggatgttaccaatcctgggcagtatggctacacgcaaggacaa
atgccgtcctacgatccgcagggataccagcagcagtaa

DBGET integrated database retrieval system