KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9890
Entry
Dmel_CG9890       CDS       T00030                                 

Gene name
CG9890
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-C2H2_2 zf-C2HE zf-C2H2 zf-C2H2_jaz zf-C2H2_4
Other DBs
NCBI-GeneID: 37659
NCBI-ProteinID: NP_611750
FlyBase: FBgn0034814
UniProt: Q9W1V7
Position
2R
AA seq 452 aa
MEHEVAVSGGDSSLEEITGSSKLKPSKNTAIKCLKCDKVYIFPSDKDDCLAHLYMEHRLV
IADVEDIALLEDYLQYWEKEFHTHEFEQYCTTMFLDQLPDGKYAKNEKYYLLCDILPQDY
ELRRRLKEKRLSEALERHQFELTDRTFSKECLFCRAIIKGLRADYLDHLFDKHFLLVGKP
EKLVYVDELLDHLEENLNRLMCLYCEKIFRDRPTLKEHMRKKGHKRINPNRREYDKYFLI
NYNRVPTAPTPRKQHLQKRRRETASVSTVADPETGSVDFDKHFARPDSDGEHDSDWSDWA
ADGEPSSIKCLFCHHLGDNFTALKKHMHEVHRLDFEKATSSLNFYQRVKVVNYLRRQMCL
LRCVTCDLQFDEEELLVEHMAQESHHGIGDKESWDKPEFFFPYIENDGLLCVLDDSGGDD
PDVDTVRIISEDSLAQINKDAERLSLENFKLL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggagcacgaggtggctgtttcaggaggggattcctcgctggaggagatcactggcagt
tcgaaactcaagccctccaagaacacggccatcaagtgcctgaaatgcgacaaggtgtac
atatttccgtcagataaagatgactgcctggcgcatttgtatatggagcaccgactggtc
atcgccgatgtggaggatatagcgcttctggaggactacctccagtactgggaaaaggag
tttcacacccacgaattcgagcaatattgcaccacaatgttcctggatcagctgcccgat
ggcaagtacgccaagaacgaaaagtactacctgctgtgtgacatcctgccccaggactac
gagctgcggcgaaggttgaaggagaagcgcctaagtgaagccctggagcgacatcagttc
gagctaaccgaccgcaccttctccaaggagtgccttttctgcagggccatcatcaaggga
ttgagggcggactatctggaccatctgtttgacaagcactttctgttggtcggcaagccc
gagaagctggtgtatgtggacgaactgctggatcacctggaggagaacttgaatcggtta
atgtgcctctactgcgagaagatcttcagggatcggcccacgctcaaggaacacatgcgc
aagaagggccacaagcggatcaatccgaaccgaagggagtacgacaagtacttccttatc
aactacaatcgtgtaccaacggcccccacgccccggaaacagcacctccaaaagcgaaga
cgggaaacggcatccgtgtccacagttgctgatcctgaaaccggcagcgtggacttcgac
aagcacttcgctcgccctgattcggatggcgaacacgattcggactggtcggattgggcg
gcagatggtgagcctagctccattaagtgcctgttttgccaccatctcggcgacaacttc
accgccctcaagaagcacatgcacgaggttcatcgcttggatttcgagaaggccaccagc
tctctgaacttctaccaacgcgtcaaggtggtcaactacctgcgccgccaaatgtgcctg
ctgcgctgcgtgacctgcgatctgcagttcgacgaggaggagctgctcgtggagcacatg
gcacaagagtcgcaccacggaatcggcgataaggagagctgggacaagcccgagttcttc
ttcccgtacatcgagaacgatggtctgctgtgtgtgctggatgattccggaggcgatgac
ccggacgtcgatacggtgcgcatcatctccgaggatagtctggcgcagatcaacaaggat
gcggagcggttgtccctcgagaattttaagctgttgtaa

DBGET integrated database retrieval system