KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9998
Entry
Dmel_CG9998       CDS       T00030                                 

Gene name
U2af50
Definition
(RefSeq) U2 small nuclear riboprotein auxiliary factor 50, isoform D
  KO
K12837  splicing factor U2AF 65 kDa subunit
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dmel_CG9998 (U2af50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG9998 (U2af50)
Spliceosome [BR:dme03041]
 Complex A
  U2 snRNP components
   U2 related factors
    Dmel_CG9998 (U2af50)
 Complex B
    Dmel_CG9998 (U2af50)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 32602
NCBI-ProteinID: NP_001245710
FlyBase: FBgn0005411
UniProt: Q24562 M9NDZ4
Position
X
AA seq 416 aa
MGYDDRERDRERRRHRSRSRDRHRERSRDRRHHRNSRRKPSLYWDVPPPGFEHITPMQYK
AMQASGQIPASVVPDTPQTAVPVVGSTITRQARRLYVGNIPFGVTEEEMMEFFNQQMHLV
GLAQAAGSPVLACQINLDKNFAFLEFRSIDETTQAMAFDGINLKGQSLKIRRPHDYQPMP
GITDTPAIKPAVVSSGVISTVVPDSPHKIFIGGLPNYLNDDQVKELLLSFGKLRAFNLVK
DAATGLSKGYAFCEYVDLSITDQSIAGLNGMQLGDKKLIVQRASVGAKNAQNAANTTQSV
MLQVPGLSNVVTSGPPTEVLCLLNMVTPDELRDEEEYEDILEDIKEECTKYGVVRSVEIP
RPIEGVEVPGCGKVFVEFNSVLDCQKAQQALTGRKFSDRVVVTSYFDPDKYHRREF
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgggatatgatgaccgtgaacgcgatcgcgagagacgccgacatcgttcccgctctcgg
gaccgccatcgcgaacgctccagggatcgacgccatcaccggaactcgaggcgcaagccg
tcgctttattgggatgtaccgccgccgggattcgagcacatcaccccgatgcaatacaaa
gccatgcaggcgtccggacaaatcccggcaagcgttgtgccggatacaccacaaacggca
gtgcccgtggtcggatcgacaattacccgacaggcgcgtcgcctgtacgttggcaacatt
ccgtttggcgtcaccgaggaggaaatgatggagttcttcaaccaacagatgcatttagtt
gggctcgcccaggcggccggcagtcccgtcttggcatgccaaattaacttggacaaaaac
tttgctttcctcgaattccgatcgattgatgaaaccacccaggccatggcattcgatggc
atcaatttgaaggggcagagcttaaagattaggcgtccgcacgattaccagcccatgccg
ggtataacagatacgccggcaattaagcccgctgttgtttccagtggagttatttcgaca
gtggttccggactcgcctcacaaaatcttcatcggaggtctaccaaactatctgaatgac
gatcaggttaaggaactgcttttgtcgtttggcaagctacgagccttcaacctggttaag
gatgccgctactgggttgagtaagggttatgctttctgtgaatatgtcgatcttagcatc
acagatcagtcgattgctggcctaaatggaatgcagctgggtgacaaaaaactgattgtc
caacgagccagtgtgggcgccaagaatgcccagaacgcggccaacaccacgcagtccgta
atgctccaagtgccgggcctgtccaatgtggtgacctctggaccgccgactgaggttctt
tgcttgctcaacatggtcacgcccgatgaactgcgggacgaggaggagtacgaggacatc
ttggaggacatcaaggaggagtgcacgaaatacggagtcgtgcggagcgtggaaattcca
cgtcccatcgagggcgtcgaagttcccggttgcggcaaggtctttgtcgaattcaactcg
gttctcgactgtcagaaggcgcagcaagcacttactggacgtaaattcagcgaccgcgtt
gtggtcacatcatatttcgatcccgacaaataccacagacgcgagttttag

DBGET integrated database retrieval system