KEGG   Dehalococcoides mccartyi GY50: GY50_0151Help
Entry
GY50_0151         CDS       T02938                                 

Gene name
oadA
Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
dmg  Dehalococcoides mccartyi GY50
Pathway
dmg00020  Citrate cycle (TCA cycle)
dmg00620  Pyruvate metabolism
dmg01100  Metabolic pathways
dmg01120  Microbial metabolism in diverse environments
dmg01200  Carbon metabolism
dmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GY50_0151 (oadA)
   00620 Pyruvate metabolism
    GY50_0151 (oadA)
Enzymes [BR:dmg01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     GY50_0151 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 RnfC_N NQRA HlyD_D23 GCV_H DUF2118 DUF561 TGT
Motif
Other DBs
NCBI-ProteinID: AHB12936
Position
137281..139044
Genome map
AA seq 587 aa AA seqDB search
MGIKITDTTLRDAHQSLIATRMRTRDMIDIAAKLDKVGFYSLEVWGGATFDSCIRFLNED
PWERLRLIRQKAPNTPLQMLLRGQNLVGYRHYADDVVREFVRLSVKNGIDIFRVFDALND
TRNMEVSIQTAKELKAHVQGTICYTTSPIHTVEKLAEMAVELEKMGCDSICIKDMAGLIT
PTAAAQLVKSIKAKVKLPVDLHSHCTSGMAPLAYYAAAEAGVDIIDTAFSAFAWGTSQPT
TESFVAAFQGTKLDTGLNLELMSEIGEEFNKISSTYRCLYTCEATQPSIGVLLHQIPGGM
ISNLVSQLRQQNAFDKLPQVLAEVPKVRADLGYPPLVTPSSQIVGTQAILNVLSGARYKQ
VTKETKNYLMGYYGKIPGAVNEEIRKAIIGDEKPVSVRPGALLEPELPKMKAEGEKLGIL
KTEEDLLTYAMYPEVAAKFLKGECKEECLLPSTPEAAKSAKTEVKAEAKSAPVLSGTAEY
SVEVDGEVFTVKVSSKAGIVGEAPKAAKPTASHPGAVVSPMQGMLLSLKVKEGDKVTEGE
VVATIEAMKMENDVTAAVSGVVSEIYAYEGEVVGSKDVIMVIEPDAK
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggtataaagataacagatacaactctgcgggatgcgcaccagtcactgatagccacc
cgaatgcgtacccgtgacatgattgatattgccgccaaactggataaggttggcttttat
tcactggaagtctggggcggtgctacatttgactcctgtatccgttttctgaatgaagac
ccctgggaacgtctccgactgatacgccagaaagcgcccaatacccctcttcagatgctt
ctccgcgggcagaatctggtgggataccgccactatgcagatgatgtggtgcgtgagttt
gtccgtttgtccgttaaaaacggcatagatattttccgggtttttgatgccttgaatgat
acccgaaatatggaagtttccatccagacggccaaagagcttaaggcccatgttcagggt
actatctgttataccaccagtcccattcataccgtagagaagctggccgagatggcagtg
gaactggaaaaaatgggctgtgattccatatgtatcaaagacatggccgggcttatcact
cctaccgctgccgcccagctggtcaagtctataaaagccaaggtcaaactgccggtggac
ctccactcacactgcaccagcggcatggcgcctttggcttattatgctgcggccgaggcc
ggggtggatataatagataccgccttttccgcctttgcctggggtacttcccagcccacc
accgaaagtttcgtggccgcttttcagggtacgaaactggataccgggcttaatctggaa
cttatgagcgaaataggtgaggaatttaataaaataagttctacttaccgctgcctttat
acctgtgaagccacccagccgagtatcggcgtgcttctccatcagatacccggcggtatg
atttccaatctggtcagccagcttcgccagcagaatgcctttgacaaactgccgcaggta
ttggccgaagtacccaaagtaagggctgatttgggctatcccccgctggttaccccgtca
agccagattgtaggtacgcaggccattttgaacgtgctgagcggcgcccgctacaaacag
gtaaccaaagaaactaaaaactatctcatggggtactacggtaaaatacccggtgcggta
aatgaagaaatacgcaaagctattatcggtgatgaaaaacccgtcagtgtcaggccgggg
gctttacttgagccggaactgcccaagatgaaagccgaaggcgaaaagctgggtatactt
aaaaccgaggaagaccttttgacttatgccatgtaccctgaggtagctgccaaattcctc
aagggtgagtgcaaagaagagtgtcttctgccgtctacgcctgaagctgccaaatctgcc
aagactgaagtgaaagctgaagccaaatccgctcctgttcttagcggtacggctgaatat
agtgtagaggtagacggagaggtctttacggtcaaggtttcttccaaggccggtatagtt
ggtgaagcccccaaggctgctaaacctactgcttcgcatccaggtgcggttgtttctccc
atgcagggtatgcttctttcactgaaggtgaaggaaggggataaggtaaccgagggtgaa
gtagtggctaccatagaagctatgaaaatggaaaatgatgtcactgccgctgtaagcggg
gtggtttcggaaatatatgcctacgaaggcgaagtggtaggcagtaaagacgttatcatg
gtgattgagccagatgctaaataa

DBGET integrated database retrieval system