KEGG   Dehalococcoides mccartyi GY50: GY50_0815Help
Entry
GY50_0815         CDS       T02938                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
dmg  Dehalococcoides mccartyi GY50
Pathway
dmg00860  Porphyrin and chlorophyll metabolism
dmg01100  Metabolic pathways
Module
dmg_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:dmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GY50_0815 (cobQ)
Enzymes [BR:dmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     GY50_0815 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB DUF1611 GATase SNO Peptidase_S51 GATase_5
Motif
Other DBs
NCBI-ProteinID: AHB13595
Position
760080..761591
Genome map
AA seq 503 aa AA seqDB search
MAKTIMIQGTSSNVGKSILVTALCRIFKQDGYKVAPFKSQNMALNAFVTKEGGEIGRAQA
VQAEACGIDPSVDMNPILMKPEADSRSQIVVNGKVDRTISAREYYEYAPLLLNTALAALN
RLREKNDIVVIEGAGSPAEINLKQREIVNMRIAKAAGAPVLLAGDIDRGGVFASLIGTVD
LLEPDERYYIKGYLINKFRGDASLLKPAIDVIEERTSIPVLGIIPYLRNMAIAQEDSVYL
DECKGSLGETDLDIAVIRLPRISNYDDFDALATDGASVRFVAKTAEIGNPDLIIIPGTKS
TIPDMEYLWQNGLAETIIKKARKGTHVLGVCGGYQILGKMIYDPHKTESENTEMKGLGLL
DAETTFEKEKSTTQVNGQVRFNNGLLADMAGCEVGGYEIHMGRTRLFSAQAAFHITNTPK
GSADYLDGASNAEGTVLGTYIHGIFESAAFRRGFLNAIRRYKGIPERQTDYFDRDKEYDK
LAEIVRASIDMEKIYAILNEGIK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaacaataatgattcagggtacttcctcaaacgtaggcaagagtatactcgta
actgctctttgccggatattcaaacaggacggctacaaagtagccccattcaaatcccag
aacatggcactgaatgccttcgttaccaaagagggcggcgaaatcggacgggcacaggct
gttcaggcagaagcctgcggaattgatcccagcgtagatatgaaccctattcttatgaag
cctgaagcagattcccgaagccagattgtggttaacggcaaagtagatcgtaccatttcc
gcccgtgagtattatgaatatgcaccgctcctgctaaataccgcactggcggcacttaac
cgcctgcgtgagaaaaatgacatcgtagttatagagggtgccggcagccctgccgaaata
aaccttaaacagcgggaaattgtgaatatgaggattgccaaggcggcaggtgcacccgta
ctcctagctggagatatagaccggggcggggtttttgcttctcttatcggtacagtagac
cttttagagcctgatgaacgttattatatcaaaggttatctgataaacaagttccggggg
gatgccagtttactgaagccggctatagatgtaatagaagaacgcacttccataccggtg
ttgggcattattccctacctgcggaatatggctattgctcaggaagattcggtttacctt
gacgaatgtaaaggcagtctgggcgaaactgacctggatattgcggtaatccgtttgccg
cgcatatcaaattacgatgattttgatgctttagctacagacggggcttcagtcaggttt
gtagctaagactgccgaaatcggcaaccctgatttgataataatcccaggtacgaaatct
accatacctgacatggagtacctgtggcagaatggtctcgctgaaactattattaaaaag
gcccgaaagggaactcacgtattaggtgtttgcggcggttatcagattttagggaaaatg
atatatgacccccataagaccgagtctgaaaatacagaaatgaaaggactaggtttgtta
gatgccgaaacaacctttgaaaaagaaaaatccaccactcaggtaaacggtcaggtcagg
tttaataacgggttgcttgcagatatggcaggttgtgaagtgggaggttatgaaatccac
atggggcgcacccggttattttctgcccaagctgcattccacatcacaaatactccaaaa
ggttcggcagattatctggatggggcatccaatgcggagggtacagtactgggtacttac
atacatggcatatttgaaagtgcagctttccgccgcggtttcttaaatgcaatccgccgc
tacaagggtattcctgaacgccagactgactattttgaccgtgacaaagagtacgacaaa
ctggcggaaatagttagagcaagtatagatatggaaaagatttatgccattttgaacgag
ggtataaaatga

DBGET integrated database retrieval system