KEGG   Desulfosporosinus meridiei: Desmer_0051Help
Entry
Desmer_0051       CDS       T02207                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00900  Terpenoid backbone biosynthesis
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desmer_0051
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Desmer_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFQ42155
UniProt: J7IKR8
Position
49547..50398
Genome map
AA seq 283 aa AA seqDB search
MGESFLTMFANAKINLALAITGVREDGFHDLQSVMQSIELHDIVKVRRYGEKIVCRCGRL
SGSGNLAYKAAMEFLEQAKLSGGIEIEIEKHIPIQAGLAGGSADAAATLCLLNRLYDEPL
STDELLKLAGICGADVAFCLQGGTMWATGRGERLEPLPKAPRIDLVLIKPDSGVNTGEAY
RQFDLLGQSGQLSKMDWEKALEEKSVHRIRELLYNDLEPASIQLVPIIQEYKKILVDLGC
SGALMSGSGSSVFGIAQGENHARQVASELRKRGFKHVWVTNTI
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatcttttcttacaatgttcgcaaatgcgaagattaatttagcattggccata
actggtgtccgggaagatgggttccatgatcttcagagtgttatgcaatccattgaatta
cacgatattgttaaggttcgtcgttatggtgaaaaaatcgtatgtcgttgtggaagatta
agtggttcgggaaatttggcctataaggcagcgatggagtttttagaacaagctaaacta
tccggtggaatagagattgaaattgaaaaacacattccgatacaggctggattagctgga
gggagtgctgatgccgcagccactctttgtttattaaatcggctttatgatgaaccctta
agcactgatgagctgcttaagctggcaggtatatgtggagcggatgtggccttttgtctt
caaggtggaaccatgtgggcaacgggacgtggtgagcggctcgagccattgcctaaagct
cccagaatagatcttgtcttaataaagccagattcaggagtgaatacgggggaggcttat
cgacagtttgacttattaggacaatcaggtcaattaagcaaaatggattgggaaaaggcc
ttagaggaaaaatcagtacacagaattagggaacttctctataatgatctggaacctgcc
tcaattcaactagttcccattattcaagaatataagaaaattttagtggatttgggatgt
tcgggagccttaatgtctggaagcggctcgagtgtatttggaattgcccaaggagagaac
catgcgaggcaagttgcatccgagttgagaaaaaggggttttaaacacgtttgggtgaca
aatactatctaa

DBGET integrated database retrieval system