KEGG   Desulfosporosinus meridiei: Desmer_0663Help
Entry
Desmer_0663       CDS       T02207                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00480  Glutathione metabolism
dmi00590  Arachidonic acid metabolism
dmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Desmer_0663
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Desmer_0663
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Desmer_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AFQ42696
UniProt: J7IVF5
Position
682547..683089
Genome map
AA seq 180 aa AA seqDB search
MSIYDYSFQSIEGKTVSLSDFQGKVMLIVNTASKCGFTPQYEGLEKLYEAYKDQGLVVIG
FPCNQFAEQEPGTNSEVQEFCKIRYGVTFPLTEKVNVRDENADPIFQYLTENTTFKGLGK
GLKNKALELMLKQKYGKQFSDNSVKWNFTKFLIGRDGKIAGRFEPTVSPESMVSSIEECL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttatgattattcatttcagtccatcgaaggtaaaacagtctctctttctgat
tttcaaggtaaggtgatgttgattgtcaacaccgccagcaaatgcggttttactccccaa
tatgagggactagagaaactttatgaagcttataaagatcaaggtttagtggtgatcggt
ttcccctgtaaccaatttgctgagcaggagccggggaccaatagtgaggttcaggagttt
tgtaagataagatatggggttaccttcccgcttacggaaaaggtgaatgtacgggatgaa
aatgctgatccaatctttcaatatcttactgaaaacacaacctttaaggggttaggtaaa
ggccttaaaaacaaagcccttgaacttatgctcaaacagaaatacggaaagcagttctct
gataactctgttaaatggaactttacaaaattcctcattggcagagacggaaaaatagca
ggccgttttgagcccactgtctcaccggaaagcatggtatcctcgattgaggagtgcttg
taa

DBGET integrated database retrieval system