KEGG   Desulfosporosinus meridiei: Desmer_0760Help
Entry
Desmer_0760       CDS       T02207                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00010  Glycolysis / Gluconeogenesis
dmi00030  Pentose phosphate pathway
dmi00051  Fructose and mannose metabolism
dmi00052  Galactose metabolism
dmi00680  Methane metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desmer_0760
   00030 Pentose phosphate pathway
    Desmer_0760
   00051 Fructose and mannose metabolism
    Desmer_0760
   00052 Galactose metabolism
    Desmer_0760
  Energy metabolism
   00680 Methane metabolism
    Desmer_0760
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desmer_0760
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desmer_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AFQ42792
UniProt: J7IM12
Position
786208..787287
Genome map
AA seq 359 aa AA seqDB search
MRKLAVLTGGGDCPGLNAVIRAIAKSAQGYGIEVLGIRDGFRGAVEGDFVPLALKDVSGI
LPRGGTILGTTNRDNPFAYQTKLNGVNQAVDRSDNVIRNFKKQGIDALLAIGGDGSLNIA
LKFVHKGLKVIGIPKTIDNDLMATDQTFGFQTAVDTAQEALDRLHTTAESHHRVMVLEVM
GRYAGWIALYAGVAGGADVILIPEIPYNLNRVALSIQKRAKQGKKFSIIVAAEGAKPLGG
EMVVERLMEGRVDPIKLGGIGAKIGHDLEEHYGMETRVTVLGHLQRGGSPNAYDRVLSTR
YGAAAVDAALEGEFGIMVALQGREIVRVPLQEAVNQIKLVPLNDPLLLAARTLGMELGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaacttgcggtccttacaggtggaggagactgccctggacttaatgcggtgatt
cgggcaattgctaaaagcgctcagggatacggaatagaagtattaggaattagagatggc
tttcgaggtgcggtagaaggggattttgtaccccttgcgttgaaggatgtttcaggaatt
ttacctcgaggaggtacgattctgggtactacgaatagagacaatccttttgcttatcaa
accaaactaaatggagtcaatcaagctgtagatcgttcagataatgtgattcgtaatttt
aagaaacaagggattgacgcattgttagccatcggtggggatgggagtttgaatatcgct
ttgaaatttgtgcataagggccttaaagtgatcgggattcctaaaaccattgacaacgat
ttaatggctactgatcagactttcggttttcaaacagcggtggatacagcccaagaagcc
ttagatcgcttacatactactgctgaatctcatcatagggtcatggtactcgaagtaatg
ggacgttacgccggctggattgctctgtatgctggggtcgccggaggtgcagatgtgatc
ctcattccggagatcccctataaccttaatcgagttgccttaagcattcagaaaagggcc
aagcaaggtaaaaaatttagcattatcgtcgcagcggaaggtgctaagcccttggggggc
gaaatggtagtcgaacgcctgatggagggacgagttgacccgattaaactaggaggaatt
ggtgccaaaataggtcatgatcttgaagaacattatggaatggaaacccgagttaccgtt
cttggacacctccaacgtggaggctcccccaatgcctatgacagagttctttcgactcgc
tatggagcggctgctgtagacgccgccctggaaggggaatttggaattatggttgcgctt
caaggaagggagattgtgcgagttccacttcaggaggctgttaaccaaattaaacttgtc
ccacttaacgatccattattgttagcggcacgcactcttggaatggaactgggagattaa

DBGET integrated database retrieval system