KEGG   Desulfosporosinus meridiei: Desmer_0860Help
Entry
Desmer_0860       CDS       T02207                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00071  Fatty acid degradation
dmi00280  Valine, leucine and isoleucine degradation
dmi00310  Lysine degradation
dmi00362  Benzoate degradation
dmi00380  Tryptophan metabolism
dmi00620  Pyruvate metabolism
dmi00630  Glyoxylate and dicarboxylate metabolism
dmi00640  Propanoate metabolism
dmi00650  Butanoate metabolism
dmi00900  Terpenoid backbone biosynthesis
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01120  Microbial metabolism in diverse environments
dmi01130  Biosynthesis of antibiotics
dmi01200  Carbon metabolism
dmi01212  Fatty acid metabolism
dmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desmer_0860
   00630 Glyoxylate and dicarboxylate metabolism
    Desmer_0860
   00640 Propanoate metabolism
    Desmer_0860
   00650 Butanoate metabolism
    Desmer_0860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desmer_0860
   00072 Synthesis and degradation of ketone bodies
    Desmer_0860
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desmer_0860
   00310 Lysine degradation
    Desmer_0860
   00380 Tryptophan metabolism
    Desmer_0860
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desmer_0860
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desmer_0860
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desmer_0860
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dmi04147]
    Desmer_0860
Enzymes [BR:dmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desmer_0860
Exosome [BR:dmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desmer_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFQ42890
UniProt: J7IMU4
Position
895486..896679
Genome map
AA seq 397 aa AA seqDB search
MQEAVIVSGVRTAVGRVGGTLKNVDVDYLAAHVIREVLKRSGIPDPAVDEVIFGHTKQSA
DNPNLARLALLRAEMPEEIPAYTVHRQCGSALTALNNAVQSIWAGTSETVMAGGAESMST
APYYLRNARYGYRMGNAEIIDSNTESQPRCQPQERYGYLTMGLTAENLAEKYEISRQEQD
EFALLSQERALKAIEKGLFKEEVVPYEIKDKKNTVIFDKDEHPKGTSMTQLSKLKPVFKE
NGSVTAGNSSGRNDGAAVLMVTTPDKAIEFGLKPLARVVGIGAKGVPPQIMGIGPVPATQ
AALKMAGLSLNQIDLIELNEAFAAQSLAVIKELGLDLNKTNVNGGAIALGHPLGATGGII
MIKLLNQLRRTGKRYGLATMCIGGGQGISTIVENLSV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggcagtcatagtatcaggggtgcgtacagcggtcggaagagtaggtggtact
cttaagaatgtagatgtagactatcttgcagcccatgtgatcagggaagtgctcaaacgc
agcggaattccagacccagcggtcgatgaagttatctttggacataccaaacaaagtgct
gacaatcccaaccttgctcgtttagcccttttaagggcagagatgccggaagaaatacct
gcttacacggtacaccgacagtgtggctcagctctgacagctttaaataatgctgtccaa
tctatctgggcaggcacttctgaaacggttatggccggtggagcagaaagcatgagtaca
gctccttactatctaaggaacgctcggtacggatatcgtatgggaaatgcggagattatt
gattctaatacagagagtcagccgcgctgtcagcctcaggaacgttatggatatctgaca
atgggattaacagcggaaaatttggctgagaaatatgagatcagccgccaggagcaggat
gaatttgccctcttaagtcaagaacgagccttaaaggctattgagaagggattgtttaaa
gaagaggtagttccctatgaaatcaaagataaaaagaataccgtgatctttgataaggat
gaacatccaaagggaaccagcatgactcagttgagtaaattaaagccagtgtttaaagag
aatggatcagtaaccgcagggaattcaagtggtcgaaatgatggggcagcggtattgatg
gtgaccaccccagacaaggccatagaatttggattaaaacccttggcccgagttgttggg
ataggggccaagggagttcctccccaaattatgggtatcgggccagtgccagcaactcaa
gcggctcttaagatggccgggttgtccttgaatcagatcgacctaatagaattaaatgaa
gcttttgccgctcagtcattggcagtgatcaaagagcttggactggacctcaacaaaaca
aatgttaatggaggagccattgcgcttgggcatcctttaggcgcaacaggtggaattatt
atgataaaattactcaatcaattaaggcgtacgggtaagagatatggcttagcaactatg
tgcataggaggaggtcagggtatctctacaatcgttgaaaacctttcagtttaa

DBGET integrated database retrieval system