KEGG   Desulfosporosinus meridiei: Desmer_1284
Entry
Desmer_1284       CDS       T02207                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00230  Purine metabolism
dmi01100  Metabolic pathways
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desmer_1284
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desmer_1284
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFQ43295
UniProt: J7INY7
Position
1331624..1333984
AA seq 786 aa
MAYTVVGKSVRRVDAVAKVTGKAKYTDDFSERNMLVGKILHSPYAHALVKSIDVSKAKAL
PGVEAVLTYKDLPDIRYATAIPGIIEAIATDDMTVAELKYGTAGHPYSLEENHRDKEDRN
ILTRKARFVGDNIAAVVAIDDLTASKALKLIEVEYEELEVLTSTDAALKEGAPLIHDDCE
GNILSSHGYEIGNLEEALQESDHVIEGEYETSIVQHCHLENQVSHAYVDSDRRIVIMTST
QIPHIVRRIVAQSLGISWGRVRVIKPYVGGGFGNKQDVCIEPLNAAMSLAVGGRPVRLEL
SREEAMIDTRTRHAFKFKIRTGINNDGKINGIHISAVSNTGAYASHGHSIASSGGGKFRY
LYPTKALKYDPITVYTNLPVAGAMRGYGTPQIFFAFESHIEDIAKQLNLDPIEIRKKNVV
KEGHVDPLSKNTIRSCSIRECIDKGRELIKWDAKKALYKNQTGDIRRGLGMACFSYASGT
YPVALELAGARIVMNQDGSVQLQLGATEIGQGSDTVFAQMVSEVLGIPMYMVHVISTQDT
DITPFDTGSYASRQTYVSGMAVEKAALEVKKKVLAFASSMTDVPAHLLDLKEQAVVFKES
GEKVLGLEVVAMQSYYDRVNAQPITSDVSNNARINAIPFGVTFAEVEVDMKTGKIKILEI
YNVHDSGKIVNPLLAEGQVHGGVSMAIGYALSEQLLFDEKTGKPLNNNLLDYKLPTIMDT
PDIGAAFVEKEDPTGPFGVKSLGEPPIVSPAPAIRNAVLDATEVAFNRIPMNPQRVFEKF
KEKGLI
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcttatacagttgtaggaaaaagcgttagaagagtcgatgctgtagccaaagtgacg
ggcaaggccaaatatacggatgatttttctgaacgaaatatgttagttgggaaaattctg
cacagtccctatgcgcatgcccttgttaaatcaatcgatgtcagcaaggcgaaagccctg
ccgggggtcgaggctgttcttacgtacaaagatttgccggatattcgctatgctacagca
atcccgggtataatcgaggctattgctactgatgacatgactgttgcagagcttaaatat
ggcacggcggggcatccctattctcttgaggaaaatcatcgagataaagaggatcgcaat
attttaactcggaaagctaggtttgtcggagacaatattgcagcagtggttgccattgat
gatttgaccgcctcgaaggctttgaaattaattgaggtggaatacgaagaattagaagtt
ttgacaagtactgatgcggcccttaaagaaggagcgccactcattcatgatgattgcgag
gggaacattctatcttcgcatggatatgaaataggaaatcttgaagaagctttacaggaa
tcggatcatgtcattgaaggtgaatatgagacgagcattgttcagcactgtcatttagaa
aatcaagtatctcatgcttatgttgattcggatcgaagaattgttatcatgacctcgacc
cagattccccatattgtgcgccggattgtcgcccaatcccttgggatctcctgggggcgg
gtacgggtgatcaagccttatgtagggggcgggttcggtaataagcaggatgtctgtatt
gagcccttaaatgccgctatgagcttagcggtcggtggtcgacctgtaagattagaactg
tcccgtgaagaggcgatgattgatacacgtactcgccatgcctttaagtttaaaatccgg
acagggattaataatgatggaaaaatcaatggtattcatatatccgccgtctccaacacg
ggagcttatgcatcccacggacattccattgccagcagcgggggaggaaagttccgttac
ctttacccgactaaggccttaaaatatgatccgataactgtgtacactaacctgccggtg
gctggggcaatgcgtgggtatggtactccccagatcttcttcgcctttgaatctcacatc
gaggatattgccaaacagcttaacctggatcccatcgagattcggaagaaaaatgtcgtc
aaggaaggtcatgtcgacccattaagtaaaaacacaattcgaagctgcagtatccgtgag
tgtatcgataaaggcagagagttaatcaagtgggatgctaagaaagccttgtataaaaat
caaaccggagatatccgtcgagggttgggtatggcttgctttagctatgcttcaggaacc
tatccagtagccttagaactggcgggtgctcgaattgtgatgaatcaagatggttcggtt
cagcttcagctgggtgctactgaaattggtcaaggaagcgacacggtctttgcgcaaatg
gtgtccgaagtcctgggaattccaatgtatatggtacatgtgataagtactcaggatacg
gatattactccctttgatactgggtcttatgcctccagacaaacttatgtctccgggatg
gctgtggaaaaggcagccttagaggtgaaaaagaaagttcttgctttcgctagcagcatg
acagatgttccggctcatctgttagaccttaaggagcaagccgttgtctttaaagaatcg
ggagaaaaggtccttgggctggaagtggttgcgatgcaatcctattatgacagagttaat
gctcagcccataaccagcgatgtctccaataatgctcgcattaatgctatcccttttggg
gttacttttgccgaagtagaagtggatatgaagactggaaaaattaagatcttagaaatc
tacaatgtccatgactcgggtaagattgtcaatccacttttggcagagggacaagttcat
ggcggagtcagcatggccatcggttatgcattgtcagagcaattgctctttgatgagaag
acgggtaaacctcttaataataatctgttggattataaacttccgaccatcatggatact
ccggatattggcgcggcctttgttgagaaagaggatcctaccggaccctttggcgtcaaa
tccttaggagaacctccgattgtttctcctgcccctgcaattcgtaatgcggtactggat
gccactgaggttgctttcaatcggatacctatgaatccacagcgtgtctttgaaaagttt
aaagaaaagggattaatctag

DBGET integrated database retrieval system