KEGG   Desulfosporosinus meridiei: Desmer_1286
Entry
Desmer_1286       CDS       T02207                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS-like protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00230  Purine metabolism
dmi01100  Metabolic pathways
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desmer_1286
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: AFQ43297
UniProt: J7IND3
Position
1334874..1335380
AA seq 168 aa
MYKRIAFTVNGKAYNFEVDVRESLLDVLRSHLGFTGAKQGCGVGECGACSVLIDGVPTDT
CIYLAVWADGKEIRTIEGVAEKNGELSEVQKAFVDEGAVQCGFCTPGLVLTTTALKESGK
DYTREELKRELSGHLCRCTGYQNILKAAEKSLEGHVCTCVDSPHYKGE
NT seq 507 nt   +upstreamnt  +downstreamnt
ttgtataaacgaattgcctttaccgtgaatggaaaagcttataattttgaagttgatgtg
cgagagtccttgctggatgtcttaagaagtcatttaggttttacaggtgccaagcaaggc
tgcggggtaggagaatgtggtgcctgcagcgtccttatcgatggtgttcctacagatact
tgcatttacttagcagtttgggctgatggcaaggagattcgaaccatcgagggtgtggcg
gaaaagaatggagaactttcagaggtgcaaaaagccttcgttgacgaaggtgctgtacag
tgcgggttttgtactcccggactggtattaaccaccacggccttaaaagagagtggaaaa
gattacacccgggaagagttaaagcgagagctgtcgggacatttgtgccgttgtaccggg
tatcagaacattttaaaagcagcggaaaagtctttagaggggcatgtttgcacttgcgtt
gacagccctcattataaaggggaataa

DBGET integrated database retrieval system