KEGG   Desulfococcus multivorans: Dmul_03140Help
Entry
Dmul_03140        CDS       T04568                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dml  Desulfococcus multivorans
Brite
KEGG Orthology (KO) [BR:dml00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Dmul_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4157
Motif
Other DBs
NCBI-ProteinID: AOY57089
Position
complement(362992..364218)
Genome map
AA seq 408 aa AA seqDB search
MAAEYFVLIIGYVFGFYMSWNIGANDVANSMASAVGAKAITIRQAIFIAGILNIVGAVFI
GSHVTDTIRKGIVSTDILTDPHMALIGALAALLASSLWVSFATWKSLPVSTTHSIVGAMV
GFGIMAGGFSVVNWGKLGSVVLSWVVSPIFSLIIAYVMFKIIVRLILVRKAAFIHGMRLS
PIFIGLAGFVVVLSFLFKTPLGNTLALSDATAVLTAAFLAAVMGFSGKWLLGRILRNEAD
GDVEEIFRRIQIGTSCYVALAQGANDVANAIGPLAVIYFLVKTGGVAPTIPVPVFLLMFG
GVGIACGIGMAGHRVMDTLGNKITTLTNTRGFSVDFAAATTVLAASKLGLPVSTTHAAVG
GVLGVGLAHGFEAVNFTIVFQIMLYWVLTVPAAALTSMVIFKILEFII
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcggaatactttgtcctgattatcggatatgttttcggtttttacatgtcatgg
aacatcggcgccaacgacgtggcgaactccatggcctccgccgtgggggccaaggccatc
accatacggcaggcgattttcatcgccggcatcctgaacatcgtcggcgccgtctttatc
ggctcccacgtcaccgacaccatccgaaagggaatcgtctccacggacattctcaccgat
ccgcatatggccctgatcggtgcactggcggccctcctggcatcgtccctgtgggtctcc
tttgccacatggaaatcccttccggtctccaccacccactccatcgtcggcgccatggtc
ggcttcggcatcatggccggcggtttttcggtcgtcaattggggaaaactgggaagcgtc
gtcctgagctgggtggtttctcccatattcagcctgatcatcgcctacgttatgttcaaa
atcatcgtccggctgattctggtccggaaggcggccttcattcacggcatgcgcctctcc
cccatttttatcggattggccggcttcgtggtggtgctctcgttcctgttcaagaccccc
ctgggcaataccctcgccctcagcgacgcgacggccgttttgaccgccgcttttctggcc
gctgtcatgggtttttcagggaaatggcttctcggccgcatcctcaggaatgaagccgac
ggcgacgtcgaggaaatttttcgcagaatccagatcgggacgtcatgttacgtggccctg
gcccagggcgccaacgacgtggccaacgccatcggtcccctggcggtcatctatttcctc
gtcaagaccggcggcgtcgcccctacgatccctgtccccgtgtttctcctgatgttcggc
ggcgtcggcatcgcctgcggcatcggcatggccggtcaccgcgtgatggacactctgggc
aacaagatcaccaccctcaccaacacccgcggcttttcggtcgacttcgcggccgccacc
acggttcttgccgcctccaaactggggctgccggtctccacgacccacgcggcggtgggc
ggcgtcctgggcgtcggcctggcccacggcttcgaggcggtcaacttcaccatcgtattc
cagatcatgctctactgggtcctgacggttccggcggcggccctgaccagtatggtcatc
ttcaagatactcgagttcatcatatag

DBGET integrated database retrieval system