KEGG   Desulfococcus multivorans: Dmul_30230Help
Entry
Dmul_30230        CDS       T04568                                 

Gene name
cbiB
Definition
(GenBank) CbiB: cobalamin biosynthesis protein
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
dml  Desulfococcus multivorans
Pathway
dml00860  Porphyrin and chlorophyll metabolism
dml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmul_30230 (cbiB)
Enzymes [BR:dml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     Dmul_30230 (cbiB)
    6.3.5.11  cobyrinate a,c-diamide synthase
     Dmul_30230 (cbiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DUF1611 VbhA MobB
Motif
Other DBs
NCBI-ProteinID: AOY59793
Position
3388749..3390227
Genome map
AA seq 492 aa AA seqDB search
MHRNDAYPETKFRRTWFLAFKEVAIKGVVIAGTRSGSGKTTITMGFMAAFRRRGLTVAPF
KVGPDFIDPGHHTRVTGAISRNLDGWMLSRVYNTAAFARAADGADIAVIEGVMGLYDGYD
GRSEAGSTAQMAKWTGVPVILIVDAKSMARSAAALVHGFESFDPELDFAGVVFNNIGSPR
HLAYLREALDGRVKMPCLGGIPRDDAVAIPERHLGLVTREEHGTSSETVRRLADLIEGHI
DLDALWRRLPDLPGIAVTRPTPISGPTADMPIVRIGVAVDKAFCFYYQDNLDLLAARGAE
IVSFSPISDPALPDALDGLYFGGGYPELFADRLAENRTLCRQVREASAAGMPIYGECGGF
MYLGREIHDMEGRSHLMTGCFPFATRMYDRLRSLGYREVTLTADTVLGQAGATLRGHEFH
YSDLEPSPEGDGVQTVYGLSDRLGRPRSGEGFQIQRTLGSYVHLHFGSRPEAAGSFVDAC
RIYRHERNRSTR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgaaacgacgcttatccggaaaccaagtttcgcagaacttggtttcttgctttt
aaggaggtcgccataaaaggggtcgtcattgccggaaccagaagcggcagcggcaaaaca
accatcacgatgggcttcatggcggccttccgcagacggggtctcacggtggcgccgttc
aaggtcgggccggatttcatcgatcccggccaccacacccgcgtcaccggcgcgatcagc
cggaacctggatggatggatgctctcccgggtttacaacacggcggcattcgccagggcc
gcggacggggcagacattgccgtcatcgagggggtcatggggctctatgacggatatgac
gggcgcagcgaagccggctccacggcccagatggccaaatggacgggcgtccccgtcatt
ctgatcgtcgacgccaaaagcatggcccgaagcgccgccgccctggtccacggcttcgaa
agcttcgatccggagctcgacttcgccggggtcgtcttcaacaacatcggcagcccgaga
catctcgcctatcttcgggaggctctggatggacgggtgaaaatgccctgcctgggcggc
atcccccgggacgacgccgtcgccatccccgaacgtcatctgggcctcgtcacccgggag
gagcacgggacatcctccgaaaccgtgcgtcgactggccgacctgatcgaaggccacatc
gatctggatgccctttggcggcgcctgccggatctccccgggatcgctgtgacacgcccc
acccccatttccggccccaccgccgacatgccgatcgtccggatcggcgtggctgtcgac
aaggccttctgcttttactatcaggacaacctcgatctccttgcagcccggggcgccgaa
attgtgtcgttttcaccgatatcggatccggcccttcccgacgcgctggacggcctctat
ttcggcgggggttatcccgagcttttcgccgatcggctggctgaaaacaggacgctctgc
cggcaggttcgggaagcgagtgcggcgggcatgcccatttacggcgaatgcggcggattc
atgtacctcggccgggaaatccatgatatggagggtcggagccatctcatgaccgggtgt
tttcccttcgccacgcggatgtacgaccgccttcgttcccttggctaccgtgaggtcacc
ctcaccgccgacacggttctggggcaggccggagccaccctccggggacacgaattccac
tattccgaccttgaaccttctcccgaaggagatggggttcaaacggtctacggcctgtcg
gaccgcttgggtcggccgcgaagcggagaagggtttcagatccaacgcaccctgggaagc
tatgtccacctccatttcggcagccgccccgaggctgccggctcgtttgtcgacgcctgt
cggatctaccgtcatgaaaggaaccgctcaacaagatga

DBGET integrated database retrieval system