KEGG   Desulfococcus multivorans: Dmul_30450Help
Entry
Dmul_30450        CDS       T04568                                 

Gene name
thlA
Definition
(GenBank) ThlA: acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dml  Desulfococcus multivorans
Pathway
dml00071  Fatty acid degradation
dml00072  Synthesis and degradation of ketone bodies
dml00280  Valine, leucine and isoleucine degradation
dml00310  Lysine degradation
dml00362  Benzoate degradation
dml00380  Tryptophan metabolism
dml00620  Pyruvate metabolism
dml00630  Glyoxylate and dicarboxylate metabolism
dml00640  Propanoate metabolism
dml00650  Butanoate metabolism
dml00900  Terpenoid backbone biosynthesis
dml01100  Metabolic pathways
dml01110  Biosynthesis of secondary metabolites
dml01120  Microbial metabolism in diverse environments
dml01130  Biosynthesis of antibiotics
dml01200  Carbon metabolism
dml01212  Fatty acid metabolism
dml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dmul_30450 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    Dmul_30450 (thlA)
   00640 Propanoate metabolism
    Dmul_30450 (thlA)
   00650 Butanoate metabolism
    Dmul_30450 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dmul_30450 (thlA)
   00072 Synthesis and degradation of ketone bodies
    Dmul_30450 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dmul_30450 (thlA)
   00310 Lysine degradation
    Dmul_30450 (thlA)
   00380 Tryptophan metabolism
    Dmul_30450 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dmul_30450 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dmul_30450 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dmul_30450 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dml04147]
    Dmul_30450 (thlA)
Enzymes [BR:dml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dmul_30450 (thlA)
Exosome [BR:dml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmul_30450 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOY59815
Position
3415026..3416315
Genome map
AA seq 429 aa AA seqDB search
MNEVVIVSGSRTAVGSFGGSLKTVSVVDMGALVMKDVLKKANLKPVLSDDMRAGVPEKLK
DQGPVDLEKQAADWDDGATPIVIDEVIMGNVLQAGQGQNPARQAMIRAGICKETPAMSLN
KVCGSGLKAIAVGASAIMSGQAEVVLAGGQENMSMAPMALPKARWGYRMELTGAGEVTDL
VVFDGLYEIFYGYHMGMTAENIVKLYGISREEQDELGVLSHNRARKAITDGLFKEEIVPV
VIKSRKGDVVFDTDERPMDTSLEKMARLKPAFKKDGSVTAGNASGINDAAAAVLMMTPEK
AKALGLQPIVRIKAFAGGGVDPAYMGLGPVPAIRKVLKTTGMTLNDIQMIELNEAFAAQA
IGCMRELDIPVEKPNQLGSGISIGHPIGCTGARQMVTCIHHMRRENLETGLISMCIGGGM
GMAMIVERV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgttatcgtcagcggctcgcggaccgctgtaggcagtttcggaggatcg
ctcaaaaccgtttcggtggtggatatgggagcactggtcatgaaagacgtcctgaaaaag
gcgaatctcaagcccgtgctgagcgacgacatgagagcgggcgttccggagaaactgaag
gaccaggggcccgttgaccttgaaaaacaggctgcggactgggacgacggcgccacgccg
atagtcatcgacgaggtcatcatgggaaacgtcctgcaagccggccagggtcagaatccc
gcccgtcaggccatgatccgggccggcatctgcaaggagacgccggccatgagtttgaac
aaggtctgcggttccgggctcaaggccatcgccgtcggtgcatcggccatcatgtccggt
caggcggaagtcgtgctggccggcggtcaggaaaacatgagcatggctcccatggctctg
cccaaagcccggtggggctatcgtatggaactgaccggcgcgggagaggtcacggacctg
gtggttttcgacggactctatgaaatcttttacggatatcacatgggcatgaccgccgaa
aacatcgtcaaactttacggcatcagccgtgaggagcaggacgaactcggcgtactgagc
cataatcgggcccgcaaggccatcaccgacggccttttcaaggaagagatcgtgcccgtg
gtcatcaagagccgcaagggcgacgtggttttcgacacggacgaacgccccatggacacc
tccctcgagaagatggccagactgaagccggccttcaagaaagacggctccgtcaccgcc
ggaaacgcctccgggatcaacgacgccgccgccgcggtgctcatgatgacccccgaaaag
gccaaagccctcggacttcagcccatcgtcaggatcaaggccttcgccggcggcggcgtg
gatccggcatacatgggcctggggccggtgccggcgattcgaaaggtgctgaaaaccacc
ggcatgaccctgaacgacatccagatgatcgagttgaacgaggcgtttgcggctcaggcc
atcggatgcatgcgggaactcgacatccccgtcgaaaaacccaaccagttgggcagcggc
atctccatcggccatcccatcggctgcaccggcgcccgtcagatggtgacctgcatccat
cacatgcgccgggaaaacctggaaaccggcctgatctccatgtgcatcgggggcggcatg
ggaatggccatgatcgtcgagcgcgtatag

DBGET integrated database retrieval system